HHsearch alignment for GI: 254780624 and conserved domain: COG1041

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair].
Probab=99.03  E-value=3.4e-10  Score=85.85  Aligned_cols=118  Identities=23%  Similarity=0.317  Sum_probs=89.4

Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCC
Q ss_conf             17999999852064467997798602335577777664138863278721332222111100000112222222222233
Q gi|254780624|r   53 HRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE  132 (265)
Q Consensus        53 ~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~  132 (265)
T Consensus       182 ~P~lAR~mVNLa~v~~G~--~vlDPFcGTGgiLiEagl-~--G~~viG~Did~~mv~gak~Nl~~y~i~~~~~~~~~Da~  256 (347)
T COG1041         182 DPRLARAMVNLARVKRGE--LVLDPFCGTGGILIEAGL-M--GARVIGSDIDERMVRGAKINLEYYGIEDYPVLKVLDAT  256 (347)
T ss_pred             CHHHHHHHHHHHCCCCCC--EEECCCCCCCHHHHHHHH-C--CCEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             989999987774164698--764576783488883664-2--75676032379998556641566276761688730221


Q ss_pred             CCCCCCCCCCCCEE--EEEECC------CHH-HHHHHCCCCHHCCCCCEEEE
Q ss_conf             34575544674036--642013------213-44320121000485211776
Q gi|254780624|r  133 TLPFEANSFDACTL--AFGIRN------MPH-ITLVLQEIYRILKCGGRLLV  175 (265)
Q Consensus       133 ~lp~~d~sfD~V~~--sf~l~~------~~d-~~~~l~e~~RvLKpGG~~~i  175 (265)
T Consensus       257 ~lpl~~~~vdaIatDPPYGrst~~~~~~l~~Ly~~~le~~~evLk~gG~~vf  308 (347)
T COG1041         257 NLPLRDNSVDAIATDPPYGRSTKIKGEGLDELYEEALESASEVLKPGGRIVF  308 (347)
T ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             2778877423588469987100245552899999999999987304848999