HHsearch alignment for GI: 254780624 and conserved domain: COG2226

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=450.03  Aligned_cols=237  Identities=48%  Similarity=0.865  Sum_probs=225.0

Q ss_pred             CEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCE
Q ss_conf             21279899999999999876342115766761480179999998520644679977986023355777776641388632
Q gi|254780624|r   18 FREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQ   97 (265)
Q Consensus        18 f~~v~~~~k~~~v~~~F~~iA~~YD~~N~~~S~G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~   97 (265)
T Consensus         1 ~~~~~~~~k~~~v~~vF~~ia~~YD~~n~~~S~g~~~~Wr~~~i~~~~~~~--g~~vLDva~GTGd~a~~~~k~~g-~g~   77 (238)
T COG2226           1 FKMVAKDEKQEKVQKVFDKVAKKYDLMNDLMSFGLHRLWRRALISLLGIKP--GDKVLDVACGTGDMALLLAKSVG-TGE   77 (238)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCC--CCEEEEECCCCCHHHHHHHHHCC-CCE
T ss_conf             972211244888999987657788754212037403999999998607899--98799966873199999999658-844


Q ss_pred             EEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHCCCCHHCCCCCEEEEEE
Q ss_conf             78721332222111100000112222222222233345755446740366420132134432012100048521177630
Q gi|254780624|r   98 IVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE  177 (265)
Q Consensus        98 v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~d~~~~l~e~~RvLKpGG~~~i~d  177 (265)
T Consensus        78 v~~~D~s~~ML~~a~~k~~~~~~~~-i~fv~~dAe~LPf~D~sFD~vt~~fglrnv~d~~~aL~E~~RVlKpgG~~~vle  156 (238)
T COG2226          78 VVGLDISESMLEVAREKLKKKGVQN-VEFVVGDAENLPFPDNSFDAVTISFGLRNVTDIDKALKEMYRVLKPGGRLLVLE  156 (238)
T ss_pred             EEEEECCHHHHHHHHHHHHCCCCCC-EEEEEECHHHCCCCCCCCCEEEEEEHHHCCCCHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             9999799999999998743247663-279970565498888765889865123527878999999987626874999987


Q ss_pred             CCCCCCCHHHHHHHHHHHC-HHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCCCEEEEEEEE
Q ss_conf             5544551011234565311-133210254288768657899999689989999999975995379998556649999998
Q gi|254780624|r  178 FSEVQGPVFKKIYDMWSFK-VIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGW  256 (265)
Q Consensus       178 f~~p~~~~~~~~~~~y~~~-iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~v~~~~~~~Gi~~i~~g~  256 (265)
T Consensus       157 ~~~p~~~~~~~~~~~~~~~~v~P~~g~~~~~~~~~y~yL~eSi~~~p~~~~l~~~~~~~gf~~i~~~~~~~G~~~l~~g~  236 (238)
T COG2226         157 FSKPDNPVLRKAYILYYFKYVLPLIGKLVAKDAEAYEYLAESIRRFPDQEELKQMIEKAGFEEVRYENLTFGIVALHRGY  236 (238)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCEEEECCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCEEEEEEEEEEEEEEEEEEE
T ss_conf             68998601699999999974765621211068499999998888589989999999866846876675330169999973


Q ss_pred             EE
Q ss_conf             11
Q gi|254780624|r  257 KC  258 (265)
Q Consensus       257 Kp  258 (265)
T Consensus       237 K~  238 (238)
T COG2226         237 KP  238 (238)
T ss_pred             CC
T ss_conf             59