HHsearch alignment for GI: 254780624 and conserved domain: COG2227

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism].
Probab=99.84  E-value=2.3e-21  Score=157.85  Aligned_cols=160  Identities=19%  Similarity=0.275  Sum_probs=123.3

Q ss_pred             CCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             99779860233557777766413886327872133222211110000011222222222223334575544674036642
Q gi|254780624|r   70 KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFG  149 (265)
Q Consensus        70 ~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~  149 (265)
T Consensus        59 ~g~~vLDvGCGgG~Lse~mAr~G---a~VtgiD~se~~I~~Ak~ha~e~gv--~i~y~~~~~edl~~~~~~FDvV~cmEV  133 (243)
T COG2227          59 PGLRVLDVGCGGGILSEPLARLG---ASVTGIDASEKPIEVAKLHALESGV--NIDYRQATVEDLASAGGQFDVVTCMEV  133 (243)
T ss_pred             CCCEEEEECCCCCHHHHHHHHCC---CEEEEECCCHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHCCCCCCEEEEHHH
T ss_conf             77708874588328649999779---9469743876778999875442463--225223329999724897448977358


Q ss_pred             ECCCHHHHHHHCCCCHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             01321344320121000485211776305544551011234565311133210254288768657899999689989999
Q gi|254780624|r  150 IRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFA  229 (265)
Q Consensus       150 l~~~~d~~~~l~e~~RvLKpGG~~~i~df~~p~~~~~~~~~~~y~~~iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~  229 (265)
T Consensus       134 lEHv~dp~~~~~~c~~lvkP~G~lf---~STinrt~ka~~~~i~~---ae~vl~~vP~gTH~-------~~k~irp~El~  200 (243)
T COG2227         134 LEHVPDPESFLRACAKLVKPGGILF---LSTINRTLKAYLLAIIG---AEYVLRIVPKGTHD-------YRKFIKPAELI  200 (243)
T ss_pred             HHCCCCHHHHHHHHHHHCCCCCEEE---EECCCCCHHHHHHHHHH---HHHHHHHCCCCCHH-------HHHHCCHHHHH
T ss_conf             7716999999999998629992899---94201388999999998---99998745886335-------88861989998


Q ss_pred             HHHHHCCCCEEEEEECCC
Q ss_conf             999975995379998556
Q gi|254780624|r  230 AVISAAGFSNVSFTNYTN  247 (265)
Q Consensus       230 ~~l~~aGF~~v~~~~~~~  247 (265)
T Consensus       201 ~~~~~~~~~~~~~~g~~y  218 (243)
T COG2227         201 RWLLGANLKIIDRKGLTY  218 (243)
T ss_pred             HHCCCCCCEEEEECCEEE
T ss_conf             732357935885034265