HHsearch alignment for GI: 254780624 and conserved domain: COG2264

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis].
Probab=99.14  E-value=6.7e-11  Score=90.39  Aligned_cols=152  Identities=24%  Similarity=0.323  Sum_probs=99.5

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCC
Q ss_conf             80179999998520644679977986023355777776641388632787213322221111000001122222222222
Q gi|254780624|r   51 GLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN  130 (265)
Q Consensus        51 G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~d  130 (265)
T Consensus       144 G~HpT-T~lcL~~Le~~~~~g~~vlDvGcGSGILaIAa~kLGA--~~v~g~DiDp~AV~aa~eNa~~N~v~~~~~~~~~~  220 (300)
T COG2264         144 GTHPT-TSLCLEALEKLLKKGKTVLDVGCGSGILAIAAAKLGA--KKVVGVDIDPQAVEAARENARLNGVELLVQAKGFL  220 (300)
T ss_pred             CCCHH-HHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC--CEEEEECCCHHHHHHHHHHHHHCCCCHHHHCCCCC
T ss_conf             87801-7999999998605898799826781599999998198--66899718889999999999976996022003456


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCHH-HHHHHCCCCHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCHHHHHHHHHCCCH
Q ss_conf             3334575544674036642013213-443201210004852117763055445510112345653111332102542887
Q gi|254780624|r  131 AETLPFEANSFDACTLAFGIRNMPH-ITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDE  209 (265)
Q Consensus       131 a~~lp~~d~sfD~V~~sf~l~~~~d-~~~~l~e~~RvLKpGG~~~i~df~~p~~~~~~~~~~~y~~~iiP~~g~~~~~~~  209 (265)
T Consensus       221 ~~~~~~-~~~~DvIVANI----LA~vl~~La~~~~~~lkpgg~lIlSG-----------I---------------l~-~-  267 (300)
T COG2264         221 LLEVPE-NGPFDVIVANI----LAEVLVELAPDIKRLLKPGGRLILSG-----------I---------------LE-D-  267 (300)
T ss_pred             CHHHCC-CCCCCEEEEHH----HHHHHHHHHHHHHHHCCCCCEEEEEE-----------E---------------CH-H-
T ss_conf             300013-68656898605----27899999999998708893699986-----------2---------------07-5-


Q ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCCCEEEEE
Q ss_conf             68657899999689989999999975995379998556649999
Q gi|254780624|r  210 EPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH  253 (265)
Q Consensus       210 ~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~v~~~~~~~Gi~~i~  253 (265)
T Consensus       268 --------------q~~~V~~a~~~~gf~v~~~~~~-~eW~~i~  296 (300)
T COG2264         268 --------------QAESVAEAYEQAGFEVVEVLER-EEWVAIV  296 (300)
T ss_pred             --------------HHHHHHHHHHHCCCEEEEEEEC-CCEEEEE
T ss_conf             --------------8999999998589768689700-8779999