HHsearch alignment for GI: 254780624 and conserved domain: KOG0820

>KOG0820 consensus.
Probab=98.16  E-value=2.2e-06  Score=61.34  Aligned_cols=91  Identities=20%  Similarity=0.365  Sum_probs=71.2

Q ss_pred             HCCCHHHHH----HHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             148017999----9998520644679977986023355777776641388632787213322221111000001122222
Q gi|254780624|r   49 SLGLHRFWK----EAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCI  124 (265)
Q Consensus        49 S~G~~r~Wr----~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i  124 (265)
T Consensus        35 d~GQHilkNp~v~~~I~~ka~~k~t--D~VLEvGPGTGnLT~~lLe~~---kkVvA~E~Dprmvael~krv~gtp~~~kL  109 (315)
T KOG0820          35 DFGQHILKNPLVIDQIVEKADLKPT--DVVLEVGPGTGNLTVKLLEAG---KKVVAVEIDPRMVAELEKRVQGTPKSGKL  109 (315)
T ss_pred             CCCHHHHCCHHHHHHHHHCCCCCCC--CEEEEECCCCCHHHHHHHHHC---CEEEEEECCCHHHHHHHHHHCCCCCCCEE
T ss_conf             3014555477889999860478998--779995798778999999720---84899940807899999986699865604


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             2222223334575544674036
Q gi|254780624|r  125 TFIEANAETLPFEANSFDACTL  146 (265)
Q Consensus       125 ~~~~~da~~lp~~d~sfD~V~~  146 (265)
T Consensus       110 qV~~gD~lK~d~P--~fd~cVs  129 (315)
T KOG0820         110 QVLHGDFLKTDLP--RFDGCVS  129 (315)
T ss_pred             EEEECCCCCCCCC--CCCEEEC
T ss_conf             6885031257885--1031122