HHsearch alignment for GI: 254780624 and conserved domain: KOG1661

>KOG1661 consensus.
Probab=98.59  E-value=2.3e-08  Score=74.02  Aligned_cols=113  Identities=19%  Similarity=0.218  Sum_probs=84.8

Q ss_pred             HHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCE-EEEECCCCCCCCCCCCCHHCCC---------CCCCCCCC
Q ss_conf             9998520644679977986023355777776641388632-7872133222211110000011---------22222222
Q gi|254780624|r   58 EAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQ-IVVADINNEMLSVGRDRAFKEN---------LQDCITFI  127 (265)
Q Consensus        58 ~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~-v~giD~s~~Ml~~a~~r~~~~~---------~~~~i~~~  127 (265)
T Consensus        70 a~~le~L~~~L~pG~s~LdvGsGSGYLt~~~~~mvg~~g~~~~GIEh~~eLVe~Sk~nl~k~i~~~e~~~~~~~~~l~iv  149 (237)
T KOG1661          70 ATALEYLDDHLQPGASFLDVGSGSGYLTACFARMVGATGGNVHGIEHIPELVEYSKKNLDKDITTSESSSKLKRGELSIV  149 (237)
T ss_pred             HHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCEEEE
T ss_conf             99999999862347310133787408999999994577766514441599999999877765047304556414864799


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHCCCCHHCCCCCEEEEE
Q ss_conf             2223334575544674036642013213443201210004852117763
Q gi|254780624|r  128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL  176 (265)
Q Consensus       128 ~~da~~lp~~d~sfD~V~~sf~l~~~~d~~~~l~e~~RvLKpGG~~~i~  176 (265)
T Consensus       150 vGDgr~g~~e~a~YDaIhvGA------aa~~~pq~l~dqL~~gGrllip  192 (237)
T KOG1661         150 VGDGRKGYAEQAPYDAIHVGA------AASELPQELLDQLKPGGRLLIP  192 (237)
T ss_pred             ECCCCCCCCCCCCCCEEEECC------CCCCCHHHHHHHHCCCCEEEEE
T ss_conf             677623477568766578766------7622479999863438728986