HHsearch alignment for GI: 254780624 and conserved domain: PRK05134

>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional.
Probab=99.96  E-value=2.8e-29  Score=208.79  Aligned_cols=201  Identities=21%  Similarity=0.319  Sum_probs=148.3

Q ss_pred             HHHHHHHHH-HHH---HHHHHCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             998763421-157---6676148017999999852064467997798602335577777664138863278721332222
Q gi|254780624|r   33 VFSRVSHRY-DVM---NDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEML  108 (265)
Q Consensus        33 ~F~~iA~~Y-D~~---N~~~S~G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml  108 (265)
T Consensus        11 ~F~~la~~WWd~~g~~~~Lh~~N~~R~--~~i~~~~~~--l~G~~ILDVGCGgG~lse~LAr~G---a~VtGID~S~~~I   83 (233)
T PRK05134         11 KFSALAARWWDPNGEFKPLHRINPLRL--NYIREHAGG--LFGKRVLDVGCGGGILSESMARLG---ATVTGIDASEENI   83 (233)
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHH--HHHHHHCCC--CCCCEEEEECCCCCHHHHHHHHCC---CEEEEECCCHHHH
T ss_conf             999889984799999607888369999--999975146--689989997558971128999679---9799987998999


Q ss_pred             CCCCCCHHCCCCCCCCCCCCCCCCCC-CCCCCCCCCCEEEEEECCCHHHHHHHCCCCHHCCCCCEEEEEECCCCCCCHHH
Q ss_conf             11110000011222222222223334-57554467403664201321344320121000485211776305544551011
Q gi|254780624|r  109 SVGRDRAFKENLQDCITFIEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK  187 (265)
Q Consensus       109 ~~a~~r~~~~~~~~~i~~~~~da~~l-p~~d~sfD~V~~sf~l~~~~d~~~~l~e~~RvLKpGG~~~i~df~~p~~~~~~  187 (265)
T Consensus        84 ~~Ar~ha~~~~l--~i~y~~~~~e~l~~~~~~~FDvV~~~EVlEHV~d~~~~l~~~~rlLKPGG~l~---lsTiNrt~~S  158 (233)
T PRK05134         84 EVARLHALESGL--KIDYRQITAEELAAEHPGQFDVVTCMEMLEHVPDPASFIRACAKLVKPGGLVF---FSTLNRNLKS  158 (233)
T ss_pred             HHHHHHHHHCCC--CCEEEECCHHHHHHHCCCCEEEEEEEHHHHHCCCHHHHHHHHHHHHCCCCEEE---EECCCCCHHH
T ss_conf             999998564434--51167514766543057863477442147753899999999999738991499---9726789899


Q ss_pred             HHHHH----HHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCC-------------CEE
Q ss_conf             23456----5311133210254288768657899999689989999999975995379998556-------------649
Q gi|254780624|r  188 KIYDM----WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN-------------GVV  250 (265)
Q Consensus       188 ~~~~~----y~~~iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~v~~~~~~~-------------Gi~  250 (265)
T Consensus       159 ~l~~i~~AEyil~~vP-------~gTH~w-------~kFi~P~el~~~l~~~~~~~~~~~G~~ynp~~~~w~~~~~~~vN  224 (233)
T PRK05134        159 YLLAIVGAEYILRMLP-------KGTHDY-------KKFIKPSELAAWLRQAGLEVQDIKGLTYNPLTNRWKLSDDVDVN  224 (233)
T ss_pred             HHHHHHHHHHHHCCCC-------CCCCCH-------HHCCCHHHHHHHHHHCCCEEEEEEEEEEECCCCEEEECCCCCCC
T ss_conf             9999999988860499-------998586-------66799999999999879957210007996567938988999814


Q ss_pred             EEEEEEEEC
Q ss_conf             999998116
Q gi|254780624|r  251 ALHSGWKCE  259 (265)
Q Consensus       251 ~i~~g~Kp~  259 (265)
T Consensus       225 Y~~~~~K~~  233 (233)
T PRK05134        225 YMLAARKPA  233 (233)
T ss_pred             EEEEEECCC
T ss_conf             589987189