HHsearch alignment for GI: 254780624 and conserved domain: PRK07580

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated.
Probab=99.87  E-value=6.6e-22  Score=161.31  Aligned_cols=198  Identities=21%  Similarity=0.322  Sum_probs=138.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHH------------CCCHHHHHHHHHHHHCCC-CCCCCEEEECCHHHHHHHHHH
Q ss_conf             9899999999999876342115766761------------480179999998520644-679977986023355777776
Q gi|254780624|r   22 PEEEKQNMVNHVFSRVSHRYDVMNDLMS------------LGLHRFWKEAMVTNLNPR-KSKDYRVLDVAGGTGDVAFRI   88 (265)
Q Consensus        22 ~~~~k~~~v~~~F~~iA~~YD~~N~~~S------------~G~~r~Wr~~~i~~l~~~-~~~~~~iLDiGcGTG~~~~~l   88 (265)
T Consensus         5 ~y~~~r~~v~~YFd~ta~--~~W~rltsd~pVs~vr~tVR~Gr~~m-r~~~l~wl~~~~dl~G~rVLDaGCGtG~la~~L   81 (230)
T PRK07580          5 NYLEHKSEVRTYFNGTGF--DRWARIYSDAPVSKVRATVRAGHQRM-RDTVLSWLPADGDLTGLSILDAGCGTGSLSIPL   81 (230)
T ss_pred             CHHHHHHHHHHHHCCHHH--HHHHHHHCCCCCHHHHHHHHHHHHHH-HHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHH
T ss_conf             788999999998464789--99999708897259999999769999-999999731059978998988187867879999


Q ss_pred             HHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCH--HHHHHHCCCCHH
Q ss_conf             641388632787213322221111000001122222222222333457554467403664201321--344320121000
Q gi|254780624|r   89 AEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMP--HITLVLQEIYRI  166 (265)
Q Consensus        89 ~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~--d~~~~l~e~~Rv  166 (265)
T Consensus        82 A~~G---a~V~avDiS~~mi~~A~~Ra~~~g~~~~v~F~~gDle~~---~G~FD~Vv~mdvLiHYp~~d~~~~l~~la~-  154 (230)
T PRK07580         82 ARRG---AKVVASDISPQMVEEARERAPEAGLDGNITFEVGDLESL---LGSFDTVVCLDVLIHYPQEDAERMLAHLAS-  154 (230)
T ss_pred             HHCC---CEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEECCCCCC---CCCCCCHHHCCCEEECCHHHHHHHHHHHHH-
T ss_conf             9779---989998389999999997558627876753896676545---798660233371554578899999999972-


Q ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             48521177630554455101123456531113321025428876865789999968998999999997599537999855
Q gi|254780624|r  167 LKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT  246 (265)
Q Consensus       167 LKpGG~~~i~df~~p~~~~~~~~~~~y~~~iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~v~~~~~~  246 (265)
T Consensus       155 -~~~~~~ifT--fAP~T~lL~~m~---------~iGklFP~~drsp~------~~p~~~~~l~~~l~~~g~~v~r~~ri~  216 (230)
T PRK07580        155 -LTRGSLIFT--FAPYTPLLALLH---------WIGGFFPGPSRTTR------IYPHREKGIRRALAEAGFKVVRTERIS  216 (230)
T ss_pred             -CCCCEEEEE--ECCCCHHHHHHH---------HHHHHCCCCCCCCC------EEECCHHHHHHHHHHCCCEEEECCCCC
T ss_conf             -558859999--689869999999---------98643899999972------697388999999996698675123325


Q ss_pred             C
Q ss_conf             6
Q gi|254780624|r  247 N  247 (265)
Q Consensus       247 ~  247 (265)
T Consensus       217 ~  217 (230)
T PRK07580        217 S  217 (230)
T ss_pred             C
T ss_conf             6