HHsearch alignment for GI: 254780624 and conserved domain: PRK10909

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional.
Probab=98.26  E-value=1e-06  Score=63.41  Aligned_cols=115  Identities=14%  Similarity=0.150  Sum_probs=80.7

Q ss_pred             HHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCC-CC
Q ss_conf             99998520644679977986023355777776641388632787213322221111000001122222222222333-45
Q gi|254780624|r   57 KEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET-LP  135 (265)
Q Consensus        57 r~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~-lp  135 (265)
T Consensus        40 REalFn~L~~~i-~~~~vLDLFAGSGalGlEALSRGA--~~v~fVE~~~~~~~~i~~N~~~l~~-~~~~ii~~da~~~L~  115 (198)
T PRK10909         40 RETLFNWLAPVI-VDARCLDCFAGSGALGLEALSRYA--AGATLLEMDRAVSQQLIKNLATLKA-GNARVVNTNALSFLA  115 (198)
T ss_pred             HHHHHHHHHHHC-CCCEEEECCCCCCHHHHHHHHCCC--CEEEEEECCHHHHHHHHHHHHHHCC-CCEEEEEHHHHHHHH
T ss_conf             999998757642-998799827774688999998799--7899997899999999999998488-867999556999862


Q ss_pred             CCCCCCCCCEEE--EEECCCHHHHHHHCCC--CHHCCCCCEEEEEECC
Q ss_conf             755446740366--4201321344320121--0004852117763055
Q gi|254780624|r  136 FEANSFDACTLA--FGIRNMPHITLVLQEI--YRILKCGGRLLVLEFS  179 (265)
Q Consensus       136 ~~d~sfD~V~~s--f~l~~~~d~~~~l~e~--~RvLKpGG~~~i~df~  179 (265)
T Consensus       116 ~~~~~fDlIF~DPPY~~~---~~~~~l~~l~~~~~L~~~gliii-E~~  159 (198)
T PRK10909        116 QPGTPHNVVFVDPPFRKG---LLEETINLLEQNGWLADDALIYV-ESE  159 (198)
T ss_pred             CCCCCEEEEEECCCCCCC---HHHHHHHHHHHCCCCCCCCEEEE-EEC
T ss_conf             559952189989997655---59999999998889189969999-954