>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins. In the archaea and bacteria, they are primarily restricted to the euryarchaeota and proteobacteria respectively; where they are either described as either nucleolar protein or tRNA/rRNA cytosine-C5-methylase. They all have the S-adenosyl methionine (SAM) binding domain and are related to bacterial Fmu (16S rRNA m5C 967 methyltransferase) where the structure of the methyl transferase domain has been determined . In the eukaryota, the majority are annotated as being 'nucleolar protein'. None of the eukaryotic members in this family have a the SAM binding signature. Despite this, the yeast Nop2p is a probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis ; localised to the nucleolus and is essential for viability . Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing . There is substantial identity between Nop2p and human p120 (NOL1), which is also called the proliferation-associated nucleolar antigen , . .

Probab=97.72 E-value=3.5e-05 Score=53.54 Aligned_cols=113 Identities=21% Similarity=0.306 Sum_probs=87.6 Q ss_pred CCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCC---- Q ss_conf 6446799779860233557777766413886327872133222211110000011222222222223334575544---- Q gi|254780624|r 65 NPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANS---- 140 (265) Q Consensus 65 ~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~s---- 140 (265) T Consensus 72 ~p~Gn~~~~vlD~AAaPGgKTT~is~~m~N~G~i~Ane~~ksR~k~L~~NI~R~G~-~n~~v~~~DgR~f~~~~~~~eif 150 (284) T TIGR00446 72 EPEGNEKERVLDMAAAPGGKTTQISALMKNEGAIVANEVSKSRTKVLIANINRMGV-LNVAVINVDGRKFGAVVLKMEIF 150 (284) T ss_pred CCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHH-EEEEEEECCCCHHHHHHCCCEEE T ss_conf 77876888799974088964899999865885189973763410667865556210-03332413763001231443034 Q ss_pred CCCCEE-----EEE--------ECCC--------HHHH-HHHCCCCHHCCC----CCEEEEEECCCC Q ss_conf 674036-----642--------0132--------1344-320121000485----211776305544 Q gi|254780624|r 141 FDACTL-----AFG--------IRNM--------PHIT-LVLQEIYRILKC----GGRLLVLEFSEV 181 (265) Q Consensus 141 fD~V~~-----sf~--------l~~~--------~d~~-~~l~e~~RvLKp----GG~~~i~df~~p 181 (265) T Consensus 151 FD~iLLDAPCSG~GvI~KD~~~~~~~~~eD~~~~s~lQkeL~~~A~d~lk~nskhGGv~V---YSTC 214 (284) T TIGR00446 151 FDRILLDAPCSGEGVIRKDPSRKKNRSEEDILEISKLQKELILAAFDALKPNSKHGGVLV---YSTC 214 (284) T ss_pred EEEEEECCCCCCCCEEEECHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEE---EECC T ss_conf 321452578798833765723311477245776467679999999875044566688889---8503

HHsearch alignment for GI: 254780624 and conserved domain: TIGR00446