HHsearch alignment for GI: 254780624 and conserved domain: TIGR02752

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species..
Probab=100.00  E-value=0  Score=340.04  Aligned_cols=230  Identities=35%  Similarity=0.656  Sum_probs=222.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             99999999998763421157667614801799999985206446799779860233557777766413886327872133
Q gi|254780624|r   25 EKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADIN  104 (265)
Q Consensus        25 ~k~~~v~~~F~~iA~~YD~~N~~~S~G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s  104 (265)
T Consensus         2 ~ke~~vh~vf~~i~~~yd~mnsvis~~~h~~Wr~~~m~~m~v~~G~--~~ldvCCGt~dW~~~l~~~~G~~G~v~Gldfs   79 (231)
T TIGR02752         2 SKEERVHKVFEKIYKKYDRMNSVISFQRHKKWRKDTMKRMNVQKGK--KALDVCCGTADWAIALAEAVGKEGEVKGLDFS   79 (231)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--HHHHHCCCCHHHHHHHHHHHCCCCCEEEEHHH
T ss_conf             4356899999999875435777888898888999998776564041--21121037337888988861777716740035


Q ss_pred             CCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHCCCCHHCCCCCEEEEEECCCCCCC
Q ss_conf             22221111000001122222222222333457554467403664201321344320121000485211776305544551
Q gi|254780624|r  105 NEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP  184 (265)
Q Consensus       105 ~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~d~~~~l~e~~RvLKpGG~~~i~df~~p~~~  184 (265)
T Consensus        80 ~nml~~~~~k~~~~~~-~~~~l~hGnam~lP~~~~~fdyvtiGfGlrnvPdy~~vl~em~rv~kPGG~~~C~~tsqP~~~  158 (231)
T TIGR02752        80 ENMLSVGKQKVKDAKL-SNVELVHGNAMELPYDDNSFDYVTIGFGLRNVPDYMTVLKEMARVVKPGGKVVCLETSQPTLP  158 (231)
T ss_pred             HHHHHHHHHHHHHHHH-HHEEEECCCHHCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHH
T ss_conf             8899999988875432-002223052001787766612577525512302699999998886279971798625776257


Q ss_pred             HHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCCCEEEEEEEEE
Q ss_conf             0112345653111332102542887686578999996899899999999759953799985566499999981
Q gi|254780624|r  185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK  257 (265)
Q Consensus       185 ~~~~~~~~y~~~iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~v~~~~~~~Gi~~i~~g~K  257 (265)
T Consensus       159 ~~~q~y~~yf~~~mP~~Gk~~ak~y~eysWlqes~~~fPG~~~l~~~f~~~G~~~v~~~~~~~G~~a~h~G~k  231 (231)
T TIGR02752       159 GFKQLYFFYFKYIMPLFGKLFAKSYKEYSWLQESAREFPGKDELAEMFKEAGLKDVEVKSYTGGVAAMHLGFK  231 (231)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHEEEEECCCCHHHHHCCCC
T ss_conf             9999999999999887778886433455777777651786789999998527011223100132123211579