HHsearch alignment for GI: 254780624 and conserved domain: pfam00891

>pfam00891 Methyltransf_2 O-methyltransferase. This family includes a range of O-methyltransferases. These enzymes utilize S-adenosyl methionine.
Probab=99.05  E-value=1.4e-09  Score=81.92  Aligned_cols=104  Identities=24%  Similarity=0.363  Sum_probs=84.0

Q ss_pred             CCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             79977986023355777776641388632787213322221111000001122222222222333457554467403664
Q gi|254780624|r   69 SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAF  148 (265)
Q Consensus        69 ~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf  148 (265)
T Consensus       100 ~~~~~vvDvGGG~G~~~~~i~~~~P-~l~~~v~Dl-p~v~~~a~~-------~~rv~~~~gdff~-~~P~--aD~y~l~~  167 (239)
T pfam00891       100 SGLSSLVDVGGGTGALAAAIVRAYP-HIKGIVFDL-PHVIADAPS-------ADRVEFVGGDFFE-SVPE--ADAILLKW  167 (239)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHCC-CCEEEEEEC-HHHHHHCCC-------CCCEEEECCCCCC-CCCC--CCEEEEEH
T ss_conf             6787689967981899999999889-983898646-877862764-------6854884487777-8888--51776401


Q ss_pred             EECCCHHH--HHHHCCCCHHCCCCCEEEEEECCCCCCC
Q ss_conf             20132134--4320121000485211776305544551
Q gi|254780624|r  149 GIRNMPHI--TLVLQEIYRILKCGGRLLVLEFSEVQGP  184 (265)
Q Consensus       149 ~l~~~~d~--~~~l~e~~RvLKpGG~~~i~df~~p~~~  184 (265)
T Consensus       168 vLH~w~d~~~~~iL~~~~~al~~~grllI~e~v~~~~~  205 (239)
T pfam00891       168 VLHDWSDEDCVKILKRCYEALPPGGKVIVVEMVLPEDP  205 (239)
T ss_pred             HHCCCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCC
T ss_conf             43159999999999999997799988999974457999