HHsearch alignment for GI: 254780624 and conserved domain: pfam01170

>pfam01170 UPF0020 Putative RNA methylase family UPF0020. This domain is probably a methylase. It is associated with the THUMP domain that also occurs with RNA modification domains.
Probab=99.20  E-value=1.8e-11  Score=94.13  Aligned_cols=107  Identities=27%  Similarity=0.332  Sum_probs=84.6

Q ss_pred             HHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99852064467997798602335577777664138863278721332222111100000112222222222233345755
Q gi|254780624|r   59 AMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEA  138 (265)
Q Consensus        59 ~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d  138 (265)
T Consensus        19 ~l~~la~~~~g--~~vlDP~CGSGtilIEAa~~~-~~~~~~G~Did~~~v~~A~~N~~~~g~~~~i~~~~~D~~~l~~~~   95 (171)
T pfam01170        19 AMVNLAGWKPG--DPLLDPFCGSGTILIEAALMG-ANVALYGSDIDRRMVRGARINAEAAGVGDKIEFVQADAADLPLLN   95 (171)
T ss_pred             HHHHHHCCCCC--CEEEECCCCCCHHHHHHHHHH-CCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCCC
T ss_conf             99998589999--978868998789999999961-358953675879999999999998289984699976665387987


Q ss_pred             CCCCCCEE--EEEECCC------HHHHHHHCCCCHHCC
Q ss_conf             44674036--6420132------134432012100048
Q gi|254780624|r  139 NSFDACTL--AFGIRNM------PHITLVLQEIYRILK  168 (265)
Q Consensus       139 ~sfD~V~~--sf~l~~~------~d~~~~l~e~~RvLK  168 (265)
T Consensus        96 ~~~d~Iv~nPPYG~r~~~~~~~~~ly~~~~~~~~~~~~  133 (171)
T pfam01170        96 GSVDTIVTDPPYGIRIGSKGALEKLYPAFLDEAKRVLR  133 (171)
T ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             88318998898201136545699999999999998689