HHsearch alignment for GI: 254780624 and conserved domain: pfam08123

>pfam08123 DOT1 Histone methylation protein DOT1. The DOT1 domain regulates gene expression by methylating histone H3. H3 methylation by DOT1 has been shown to be required for the DNA damage checkpoint in yeast.
Probab=98.14  E-value=4.2e-06  Score=59.47  Aligned_cols=118  Identities=17%  Similarity=0.166  Sum_probs=81.6

Q ss_pred             HHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCE-EEEECCCCCCCCCCCC-------CHHCCCC-CCCCCCCC
Q ss_conf             9998520644679977986023355777776641388632-7872133222211110-------0000112-22222222
Q gi|254780624|r   58 EAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQ-IVVADINNEMLSVGRD-------RAFKENL-QDCITFIE  128 (265)
Q Consensus        58 ~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~-v~giD~s~~Ml~~a~~-------r~~~~~~-~~~i~~~~  128 (265)
T Consensus        32 s~ii~~~~l~~~--dvF~DLGSGVGnvv~QaAl~tg--c~~s~GiEi~~~~a~~A~~~~~~~~~~~~~~G~~~~~~~l~~  107 (205)
T pfam08123        32 SDVLDKCNLGPQ--DVFVDLGSGVGNCVLQAALEFG--CKLSFGCEIMDNASNLAELQDEEFKKRCKLFGKKLGKIEFIR  107 (205)
T ss_pred             HHHHHHHCCCCC--CEEEECCCCCCHHHHHHHHHHC--CCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             999998398976--8899858883299999998709--653888886566899999999999999999588768738997


Q ss_pred             CCCCCCCCCC---CCCCCCEEE-EEECCCHHHHHHHCCCCHHCCCCCEEEEEECCCC
Q ss_conf             2233345755---446740366-4201321344320121000485211776305544
Q gi|254780624|r  129 ANAETLPFEA---NSFDACTLA-FGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV  181 (265)
Q Consensus       129 ~da~~lp~~d---~sfD~V~~s-f~l~~~~d~~~~l~e~~RvLKpGG~~~i~df~~p  181 (265)
T Consensus       108 gdFl~~~~~~~~~~~a~VI~vNN~~F--~~~Ln~~L~e~f~~lk~GtkIVS~k~f~p  162 (205)
T pfam08123       108 GSFLDNERVEEIIPEADVILVNNFAF--DPELNLQLKEMLQDLKDGCKIISLKSFVP  162 (205)
T ss_pred             CCCCCCHHHHHHHCCCCEEEEECCCC--CHHHHHHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             77788588998634798899943246--98899999999972999888997765468