BLAST/PSIBLAST alignment of GI: 254780624 and GI: 190890022 at iteration 1
>gi|190890022|ref|YP_001976564.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium etli CIAT 652] Length = 258
>gi|218513236|ref|ZP_03510076.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium etli 8C-3] Length = 258
>gi|254790017|sp|B3PZ92|UBIE_RHIE6 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase ubiE Length = 258
>gi|190695301|gb|ACE89386.1| ubiquinone/menaquinone biosynthesis methyltransferase protein [Rhizobium etli CIAT 652] Length = 258
 Score =  360 bits (923), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 165/258 (63%), Positives = 198/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+TSYGFREVP  EKQ +VN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 1   MSESRTSADGGMETSYGFREVPGGEKQGLVNQVFHKVAKRYDIMNDVMSMGMHRVWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 61  IAALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFEA SFDA T+AFGIRN+P I + L E YR+LK GGRLLVLEFSE
Sbjct: 121 SANLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDVALAEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 181 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           S TNYT G+ ALHSGWK 
Sbjct: 241 SHTNYTGGIAALHSGWKL 258