RPSBLAST alignment for GI: 254780624 and conserved domain: PLN02490

>gnl|CDD|178108 PLN02490, PLN02490, MPBQ/MSBQ methyltransferase. Length = 340
 Score = 61.8 bits (150), Expect = 2e-10
 Identities = 51/191 (26%), Positives = 82/191 (42%), Gaps = 34/191 (17%)

Query: 56  WKEAMVTN-LNPRK--SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGR 112
           W E M  + L P     ++ +V+DV GGTG     I +  D ++ + + D +   L+  +
Sbjct: 96  WTEDMRDDALEPADLSDRNLKVVDVGGGTGFTTLGIVKHVDAKN-VTILDQSPHQLAKAK 154

Query: 113 DRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGR 172
               KE L++C   IE +AE LPF  +  D    A  I   P     ++E YR+LK GG+
Sbjct: 155 Q---KEPLKEC-KIIEGDAEDLPFPTDYADRYVSAGSIEYWPDPQRGIKEAYRVLKIGGK 210

Query: 173 LLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVI 232
             ++      GPV    +          L RF A          +    FP ++++    
Sbjct: 211 ACLI------GPVHPTFW----------LSRFFA----------DVWMLFPKEEEYIEWF 244

Query: 233 SAAGFSNVSFT 243
           + AGF +V   
Sbjct: 245 TKAGFKDVKLK 255