BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus Liberibacter asiaticus str. psy62] (265 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 265 Score = 554 bits (1428), Expect = e-160, Method: Compositional matrix adjust. Identities = 265/265 (100%), Positives = 265/265 (100%) Query: 1 MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60 MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM Sbjct: 1 MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60 Query: 61 VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120 VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL Sbjct: 61 VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120 Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE Sbjct: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180 Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV Sbjct: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240 Query: 241 SFTNYTNGVVALHSGWKCENIGSVV 265 SFTNYTNGVVALHSGWKCENIGSVV Sbjct: 241 SFTNYTNGVVALHSGWKCENIGSVV 265 >gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 559 Score = 30.8 bits (68), Expect = 0.024, Method: Compositional matrix adjust. Identities = 14/56 (25%), Positives = 29/56 (51%) Query: 144 CTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIP 199 C ++F ++P + LV +I I+K L+ + + + ++D+WSF +P Sbjct: 39 CGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVP 94 >gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 30.0 bits (66), Expect = 0.043, Method: Compositional matrix adjust. Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 5/92 (5%) Query: 36 RVSHRYDVMNDLMSLGLH----RFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEA 91 R HR + ++ ++ G H W + + TN+ ++ Y D+ TG R E Sbjct: 156 RKLHRANGIDTNITTGYHVIEFLLWGQDLKTNVREPGNRPYTDFDIGNCTGGHCRRRVEY 215 Query: 92 SDNRSQIVVADINNEMLSVGRD-RAFKENLQD 122 S+I+V+D+ M + G D +A K+ ++D Sbjct: 216 LKVVSKILVSDLEEMMKAWGPDGQATKDLMKD 247 >gi|254780582|ref|YP_003064995.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 28.9 bits (63), Expect = 0.084, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 23/43 (53%) Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176 LP +S D + + L+L EI+R+L GGR++V+ Sbjct: 89 LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131 >gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 23.5 bits (49), Expect = 3.5, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 181 VQGPVFKKIYDMWS 194 ++ P+FKKIYD +S Sbjct: 72 LRTPIFKKIYDYYS 85 >gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62] Length = 1246 Score = 22.7 bits (47), Expect = 6.7, Method: Compositional matrix adjust. Identities = 8/29 (27%), Positives = 18/29 (62%) Query: 9 DNNMKTSYGFREVPEEEKQNMVNHVFSRV 37 +NNMK ++ F E+ ++ K+ +H+ + Sbjct: 166 NNNMKDAFRFLELAQKSKETADSHIIEAI 194 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.136 0.405 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 168,151 Number of Sequences: 1233 Number of extensions: 6588 Number of successful extensions: 18 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 7 length of query: 265 length of database: 328,796 effective HSP length: 72 effective length of query: 193 effective length of database: 240,020 effective search space: 46323860 effective search space used: 46323860 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)