HHSEARCH alignment of GI: 254780625 and SCOP domain: d1k3xa1

Alignment
>d1k3xa1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]}
Probab=99.94  E-value=2.4e-27  Score=192.81  Aligned_cols=86  Identities=23%  Similarity=0.410  Sum_probs=81.7

Q ss_pred             CCCCCCCCCCHHHHHHHHHHC---CCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             555332211106788874201---45421001112654356413689999998717877831222200101589999999
Q gi|254780625|r  142 LGPEPADNSFNAIYLTHQFHK---KNSNLKNALLNQKIVAGIGNIYVCEALWRAKLSPIRKTRSLIQNNGTPKDILYKLI  218 (289)
Q Consensus       142 lGpD~l~~~~~~~~~~~~l~~---~~~~Ik~~LlDQ~~iaGIGN~y~~EiLf~a~I~P~~~~~~Ls~~e~~~~~~~~~L~  218 (289)
                      ||||||+++|+.+.|.+.+.+   ++++||++||||++||||||||+|||||+|+|||++++++|+++|      +++|+
T Consensus         1 lGPD~l~~~~~~~~~~~~l~~~~~~~~~Ik~~LlDQ~~~aGIGN~~~~EiL~~a~i~P~~~~~~L~~~~------~~~L~   74 (89)
T d1k3xa1           1 VGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQ------LDALA   74 (89)
T ss_dssp             CCCBTTCTTCCHHHHHHHHHSTTTTTSCHHHHTTCTTTSBTCCHHHHHHHHHHHTCCSSCCGGGSCHHH------HHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHCCHHH------HHHHH
T ss_conf             987969986899999999986202555299998468630354758999999996666047130199999------99999


Q ss_pred             HHHHHHHHHHHHCCC
Q ss_conf             987887676542188
Q gi|254780625|r  219 QEIQKVLIDAIDAGG  233 (289)
Q Consensus       219 ~~i~~vl~~a~~~gG  233 (289)
                      +++++++..||+.||
T Consensus        75 ~~~~~v~~~a~~~gG   89 (89)
T d1k3xa1          75 HALLEIPRFSYATRG   89 (89)
T ss_dssp             HHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             999999999998069


SCOP domain information

class: All alpha proteins
fold: S13-like H2TH domain
superfamily: S13-like H2TH domain
family: Middle domain of MutM-like DNA repair proteins
domain: Endonuclease VIII
species: Escherichia coli [TaxId: 562]