PSIBLAST alignment of GI: 254780625 and protein with PDB id: 1k3w

>gi|24987423|pdb|1K3W|A Chain A, Crystal Structure Of A Trapped Reaction Intermediate Of The Dna Repair Enzyme Endonuclease Viii With Dna Length = 262
>gi|24987426|pdb|1K3X|A Chain A, Crystal Structure Of A Trapped Reaction Intermediate Of The Dna Repair Enzyme Endonuclease Viii With Brominated-Dna Length = 262
 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 59/290 (20%), Positives = 107/290 (36%), Gaps = 32/290 (11%)

Query: 2   PELPEVEIIRRNLMMVMKNMTVTDICLHRKNLRFDFPHHFSAATRGKKIIDVSRRAKYLL 61
           PE PE+     NL   +K   +TD+      L       + +   G+ +  V  R K LL
Sbjct: 1   PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQL-----KTYQSQLIGQHVTHVETRGKALL 55

Query: 62  IELEGNLSIIVHLGMSGSFIIEHTSCAKPIKNPQHNHVTISLTNNTNTKKYRVIYNDPRR 121
                +L++  H  + G + +  T             +           K  ++Y+    
Sbjct: 56  THFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKL-------QTADKTILLYSASD- 107

Query: 122 FGFMDLVETSLKYQYPPLRTLGPEPADNSFNAIYLTHQ---FHKKNSNLKNALLNQKIVA 178
              ++++       +P L+ +GP+  D +     +  +      +N      LL+Q  +A
Sbjct: 108 ---IEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLA 164

Query: 179 GIGNIYVCEALWRAKLSPIRKTRSLIQNNGTPKDILYKLIQEIQKVLIDAIDAGGSSLRD 238
           G+GN    E LW+  L+   K + L          L  L   + ++   +    G     
Sbjct: 165 GLGNYLRVEILWQVGLTGNHKAKDLNAAQ------LDALAHALLEIPRFSYATRGQ---- 214

Query: 239 YVHIDGSIGYFQNAFSVYGKTGEPCLSNCGQMIRRIVQAGRSTFYCTYCQ 288
            V  +   G     F V+ + GEPC   CG +I +   + R  ++C  CQ
Sbjct: 215 -VDENKHHGAL-FRFKVFHRDGEPC-ERCGSIIEKTTLSSRPFYWCPGCQ 261