HHsearch alignment for GI: 254780626 and conserved domain: CHL00102

>CHL00102 rps20 ribosomal protein S20.
Probab=99.93  E-value=1.1e-25  Score=174.10  Aligned_cols=86  Identities=35%  Similarity=0.370  Sum_probs=83.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             96898999999999999999999999999999999999960-----8989999999999999999986588616699999
Q gi|254780626|r    1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITF-----GKIEEATEACRKAESVIQKAKSKGIFHGNAASRK   75 (90)
Q Consensus         1 Man~kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~-----~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRk   75 (90)
T Consensus         1 MAN~kSa~KRi~~~ErnRlrNkayKS~vrT~~Kk~~~a~e~~~~~~~~~~~~~~~l~~a~s~IDKAVkkGvlHkNtaArk   80 (93)
T CHL00102          1 MANNKSAIKRIQISERNRLRNRAYKSVVKTLTKKYLKDLENYKNSNNNKEKLQLLLSIVYSKIDKAVKKGVFHKNTAARK   80 (93)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             99708789999999999998799999999999999999998723898199999999999999999987288677608889


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999998
Q gi|254780626|r   76 VSRLSKRLKGI   86 (90)
Q Consensus        76 KSrL~~~v~~~   86 (90)
T Consensus        81 KSrLa~~~k~~   91 (93)
T CHL00102         81 KSKLAKALKIS   91 (93)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999998774