HHsearch alignment of GI: 254780626 and MMDB domain: 2vqe_T_

>2vqe_T (T:) 30S ribosomal protein S20; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}
Probab=99.96  E-value=1.8e-28  Score=190.48  Aligned_cols=90  Identities=37%  Similarity=0.470  Sum_probs=88.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             96898999999999999999999999999999999999960898999999999999999998658861669999999999
Q gi|254780626|r    1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS   80 (90)
Q Consensus         1 Man~kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRkKSrL~   80 (90)
                      ||||+|++||+||++++|++|++++|++||++|+|+.+|++||.+++.++|+.+++.||+++++||||+|+|+|+||||+
T Consensus         6 MaN~kSA~KRir~~~krr~rNr~~kS~ikT~iKk~~~Ai~~~d~~~a~~~l~~a~s~iDkaa~KGiiHkN~AaRkKSRL~   85 (106)
T 2vqe_T            6 PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLM   85 (106)
T ss_dssp             --CCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTTTTSSCTTHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             78986189999999999999999999999999999999872789999999999999999998679876013889999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999984269
Q gi|254780626|r   81 KRLKGILTSA   90 (90)
Q Consensus        81 ~~v~~~~~~A   90 (90)
                      ..|+++..+|
T Consensus        86 ~~in~~~~~a   95 (106)
T 2vqe_T           86 RKVRQLLEAA   95 (106)
T ss_dssp             HHHHHHHTTT
T ss_pred             HHHHHHHHHH
T ss_conf             9999998631