Query         gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 90
No_of_seqs    107 out of 1206
Neff          5.5 
Searched_HMMs 13730
Date          Wed Jun  1 09:47:52 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780626.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2uubt1 a.7.6.1 (T:8-106) Ribo  99.9   4E-26 2.9E-30  174.0  10.5   87    4-90      2-88  (99)
  2 d2gy9t1 a.7.6.1 (T:4-86) Ribos  99.9 4.1E-25   3E-29  168.0   9.6   83    5-87      1-83  (83)
  3 d1h6qa_ b.88.1.2 (A:) Translat  29.0      15  0.0011   14.5   5.9   39   22-60     82-120 (168)
  4 d256ba_ a.24.3.1 (A:) Cytochro  26.9      16  0.0012   14.3   5.5   37   26-62     66-102 (106)
  5 d3bb9a1 d.17.4.16 (A:27-147) U  25.6      17  0.0013   14.1   2.5   26   26-51      3-28  (121)
  6 d1txja_ b.88.1.2 (A:) Translat  24.7      18  0.0013   14.0   5.3   38   22-59     85-122 (171)
  7 d1yz1a1 b.88.1.2 (A:1-172) Tra  24.5      18  0.0013   14.0   5.3   39   22-60     86-124 (172)
  8 d2oo2a1 a.8.11.1 (A:1-75) Hypo  17.6      26  0.0019   13.1   7.0   46   23-68     28-73  (75)
  9 d1nzea_ a.24.18.1 (A:) Oxygen-  16.6      27   0.002   13.0   6.3   38   26-63     72-109 (112)
 10 d2pv7a1 a.100.1.12 (A:244-371)  12.5      35  0.0025   12.3   5.2   41   21-61     73-113 (128)

No 1  
>d2uubt1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
Probab=99.93  E-value=4e-26  Score=174.00  Aligned_cols=87  Identities=38%  Similarity=0.493  Sum_probs=85.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999999999999999999999999960898999999999999999998658861669999999999999
Q gi|254780626|r    4 KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL   83 (90)
Q Consensus         4 ~kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRkKSrL~~~v   83 (90)
                      |+||+||+||+++++++|++++|.|||++|+|+.+|++||.+++.++|+.+++.||+++++||||+|+|+|++|||+++|
T Consensus         2 ~~SA~KRiRq~~krr~rN~~~kS~~kT~iKk~~~ai~~~d~e~A~~~l~~a~s~iDKAakKgiiHkN~AaRkKSRL~k~v   81 (99)
T d2uubt1           2 NLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKV   81 (99)
T ss_dssp             CCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHTTSSTTCSHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             76279999999999999999999999999999999872688999999999999999998679877114889999999999


Q ss_pred             HHHHHCC
Q ss_conf             9984269
Q gi|254780626|r   84 KGILTSA   90 (90)
Q Consensus        84 ~~~~~~A   90 (90)
                      +++.++|
T Consensus        82 ~~l~~~a   88 (99)
T d2uubt1          82 RQLLEAA   88 (99)
T ss_dssp             HHHHHTS
T ss_pred             HHHHHHH
T ss_conf             9987521


No 2  
>d2gy9t1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
Probab=99.92  E-value=4.1e-25  Score=167.98  Aligned_cols=83  Identities=28%  Similarity=0.433  Sum_probs=81.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999999999999999999999608989999999999999999986588616699999999999999
Q gi|254780626|r    5 DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLK   84 (90)
Q Consensus         5 kSa~Kr~r~~~krr~~N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiihkn~AsRkKSrL~~~v~   84 (90)
                      +||+||+||+++++.+|++++|.|||++|+|+.+|++||.+++.++|+.++|.||+++++||||+|+|+|++|||+++|+
T Consensus         1 KSA~Kr~rq~~kr~~~N~~~kS~~rT~iKk~~~ai~~~d~~~a~~~~~~a~s~iDkaa~KgiiHkN~AaRkkSRL~k~v~   80 (83)
T d2gy9t1           1 KSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQIN   80 (83)
T ss_dssp             CCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHTTHHHHHHHHHTTTTCHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             96478999999999999999999999999999998759999999999999999999987797656588899999999987


Q ss_pred             HHH
Q ss_conf             984
Q gi|254780626|r   85 GIL   87 (90)
Q Consensus        85 ~~~   87 (90)
                      +++
T Consensus        81 ~~s   83 (83)
T d2gy9t1          81 KLA   83 (83)
T ss_dssp             HHC
T ss_pred             HCC
T ss_conf             609


No 3  
>d1h6qa_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
Probab=29.02  E-value=15  Score=14.49  Aligned_cols=39  Identities=18%  Similarity=0.216  Sum_probs=31.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999608989999999999999999
Q gi|254780626|r   22 KSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK   60 (90)
Q Consensus        22 ~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDk   60 (90)
                      .++++-+|.++|++..-++..+++....+-..++..+.+
T Consensus        82 k~y~~yiK~YmK~vk~~L~e~~perv~~Fk~~a~~~vK~  120 (168)
T d1h6qa_          82 KSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKK  120 (168)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSCTTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999998640888999999867999999


No 4  
>d256ba_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
Probab=26.89  E-value=16  Score=14.26  Aligned_cols=37  Identities=16%  Similarity=0.153  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999960898999999999999999998
Q gi|254780626|r   26 SSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAK   62 (90)
Q Consensus        26 s~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~   62 (90)
                      ..+-..|-.+..+++.|+.++|...+..+....+..-
T Consensus        66 d~L~~~ld~i~~la~~G~l~eAk~~l~~l~~~r~~YH  102 (106)
T d256ba_          66 DILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYH  102 (106)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999886999999999999999999976


No 5  
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}
Probab=25.62  E-value=17  Score=14.12  Aligned_cols=26  Identities=12%  Similarity=0.230  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             99999999999999608989999999
Q gi|254780626|r   26 SSVRSFMRHANEAITFGKIEEATEAC   51 (90)
Q Consensus        26 s~~kt~iKk~~~ai~~~d~~~a~~~~   51 (90)
                      +.+...++.+..|+..+|.+....+|
T Consensus         3 ~a~~~v~~~~~~A~~~~D~~~~~~l~   28 (121)
T d3bb9a1           3 SAAGNVVKQFHAALQMGNEAIVRQSL   28 (121)
T ss_dssp             SHHHHHHHHHHHHHHHTCHHHHHHHE
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             68999999999999858999999851


No 6  
>d1txja_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Plasmodium knowlesi [TaxId: 5850]}
Probab=24.70  E-value=18  Score=14.02  Aligned_cols=38  Identities=16%  Similarity=0.188  Sum_probs=28.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999960898999999999999999
Q gi|254780626|r   22 KSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ   59 (90)
Q Consensus        22 ~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lD   59 (90)
                      .++++-+|.++|++..-++...++....+-..++..+-
T Consensus        85 k~y~~yiK~YmK~v~~~L~e~~perV~~Fk~~a~~~vK  122 (171)
T d1txja_          85 KEYSVYIKNYMQKILKYLEEKKPDRVDVFKTKAQPLIK  122 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHH
T ss_conf             99999999999999998764097789999987899999


No 7  
>d1yz1a1 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
Probab=24.45  E-value=18  Score=13.99  Aligned_cols=39  Identities=10%  Similarity=0.196  Sum_probs=28.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999608989999999999999999
Q gi|254780626|r   22 KSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK   60 (90)
Q Consensus        22 ~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDk   60 (90)
                      .++++-+|.++|++..-++..+.+....+-..++..+-+
T Consensus        86 k~y~~yiK~YmK~v~~~L~e~~~e~v~~F~~~a~~~vK~  124 (172)
T d1yz1a1          86 EAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKH  124 (172)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999987631988999999876999999


No 8  
>d2oo2a1 a.8.11.1 (A:1-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=17.58  E-value=26  Score=13.11  Aligned_cols=46  Identities=13%  Similarity=0.147  Sum_probs=39.6

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             9999999999999999960898999999999999999998658861
Q gi|254780626|r   23 SRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFH   68 (90)
Q Consensus        23 ~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~kkgiih   68 (90)
                      ......+.++..-...++.||...|...++=+.--||-.+.=|+++
T Consensus        28 ~~l~ma~~Y~~Da~~fl~~gD~v~A~~~~~Ya~gwlDag~rlG~~~   73 (75)
T d2oo2a1          28 GFMRNIEAYISDSRYFLEKGDLVRAFECVVWAWAWLEIGLEVGKLH   73 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHTTSEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999989999887879999999999999999889824201


No 9  
>d1nzea_ a.24.18.1 (A:) Oxygen-evolving enhancer protein 3, {Spinach (Spinacia oleracea) [TaxId: 3562]}
Probab=16.57  E-value=27  Score=12.96  Aligned_cols=38  Identities=18%  Similarity=0.114  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999608989999999999999999986
Q gi|254780626|r   26 SSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKS   63 (90)
Q Consensus        26 s~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka~k   63 (90)
                      ..+-..+-.+..++..+|..++...+..+.+.||....
T Consensus        72 ~~lf~~le~LD~Aar~kd~~~a~~~Y~~t~~~ld~~la  109 (112)
T d1nzea_          72 SKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLA  109 (112)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999748899999999999999999998


No 10 
>d2pv7a1 a.100.1.12 (A:244-371) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}
Probab=12.51  E-value=35  Score=12.29  Aligned_cols=41  Identities=10%  Similarity=-0.009  Sum_probs=32.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999996089899999999999999999
Q gi|254780626|r   21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKA   61 (90)
Q Consensus        21 N~~~ks~~kt~iKk~~~ai~~~d~~~a~~~~~~~~s~lDka   61 (90)
                      +......+...+..+..+|+.||.++....|.++...++--
T Consensus        73 ~~~~l~~~~~~l~~l~~~i~~~D~~~l~~~~~~a~~~~~~~  113 (128)
T d2pv7a1          73 NLAVIETLKQTYDEALTFFENNDRQGFIDAFHKVRDWFGDY  113 (128)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999998399999999999999999876


Done!