BLAST/PSIBLAST alignment of GI: 254780626 and GI: 15887673 at iteration 1
>gi|15887673|ref|NP_353354.1| 30S ribosomal protein S20 [Agrobacterium tumefaciens str. C58] Length = 88
>gi|22096131|sp|Q8UIH2|RS20_AGRT5 RecName: Full=30S ribosomal protein S20 Length = 88
>gi|15155226|gb|AAK86139.1| 30S ribosomal protein S20 [Agrobacterium tumefaciens str. C58] Length = 88
 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 63/86 (73%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR F+R   EAI  G +  ATEA + A+  IQ+
Sbjct: 1  MANTTSAKKATRKIARRTAVNKARRSRVRGFIRKVEEAIATGDLAVATEALKAAQPEIQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++G+ HGN ASRKVSRL++R+K +
Sbjct: 61 AATRGVLHGNTASRKVSRLAQRVKAL 86