BLAST/PSIBLAST alignment of GI: 254780626 and GI: 220927408 at iteration 1
>gi|220927408|ref|YP_002502710.1| 30S ribosomal protein S20 [Methylobacterium nodulans ORS 2060] Length = 88
>gi|254813095|sp|B8IQW2|RS20_METNO RecName: Full=30S ribosomal protein S20 Length = 88
>gi|219952015|gb|ACL62407.1| ribosomal protein S20 [Methylobacterium nodulans ORS 2060] Length = 88
 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKIA+RT IN+SRRS +R+FMR   EAI  G    A  A R AE  I +
Sbjct: 1  MANTVSAKKMTRKIAKRTAINRSRRSRMRTFMRKVEEAIASGDAANALAALRSAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N ASRKVSRL+ R+K +
Sbjct: 61 ASQKGIVHKNTASRKVSRLAARVKAL 86