BLAST/PSIBLAST alignment of GI: 254780626 and GI: 319898308 at iteration 1
>gi|319898308|ref|YP_004158401.1| 30S ribosomal protein S20 [Bartonella clarridgeiae 73] Length = 88
>gi|319402272|emb|CBI75811.1| 30S ribosomal protein S20 [Bartonella clarridgeiae 73] Length = 88
 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 61/86 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT INK+RRS VR+F+R  ++A+ FG  E A  A +  E  I +
Sbjct: 1  MANTPSAKKAVRKIAARTQINKARRSRVRTFIRKLDDALAFGDKEFAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVLHKNTAARKVSRLAKRLKAL 86