BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20
[Candidatus Liberibacter asiaticus str. psy62]
         (90 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040303|gb|ACT57099.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 90

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/90 (100%), Positives = 90/90 (100%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK
Sbjct: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          AKSKGIFHGNAASRKVSRLSKRLKGILTSA
Sbjct: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90


>gi|315121827|ref|YP_004062316.1| 30S ribosomal protein S20 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495229|gb|ADR51828.1| 30S ribosomal protein S20 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 90

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/86 (76%), Positives = 76/86 (88%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKIARRTL+NKSRRS VR+F+R ANEAI  GK+EEATEAC+KAES++QK
Sbjct: 1  MANTQSAKKMVRKIARRTLLNKSRRSFVRTFIRRANEAIAVGKVEEATEACKKAESLVQK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          AKSKG+FH N ASR VSRLSKRLK +
Sbjct: 61 AKSKGVFHRNTASRTVSRLSKRLKNM 86


>gi|15887673|ref|NP_353354.1| 30S ribosomal protein S20 [Agrobacterium tumefaciens str. C58]
 gi|22096131|sp|Q8UIH2|RS20_AGRT5 RecName: Full=30S ribosomal protein S20
 gi|15155226|gb|AAK86139.1| 30S ribosomal protein S20 [Agrobacterium tumefaciens str. C58]
          Length = 88

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 63/86 (73%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR F+R   EAI  G +  ATEA + A+  IQ+
Sbjct: 1  MANTTSAKKATRKIARRTAVNKARRSRVRGFIRKVEEAIATGDLAVATEALKAAQPEIQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++G+ HGN ASRKVSRL++R+K +
Sbjct: 61 AATRGVLHGNTASRKVSRLAQRVKAL 86


>gi|325291757|ref|YP_004277621.1| 30S ribosomal protein S20 [Agrobacterium sp. H13-3]
 gi|325059610|gb|ADY63301.1| 30S ribosomal protein S20 [Agrobacterium sp. H13-3]
          Length = 88

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 63/86 (73%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR F+R   EAI  G +  ATEA + A+  IQ+
Sbjct: 1  MANTTSAKKATRKIARRTAVNKARRSRVRGFIRKVEEAIASGDLAVATEALKAAQPEIQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++G+ HGN ASRKVSRL++R+K +
Sbjct: 61 AATRGVLHGNTASRKVSRLAQRVKAL 86


>gi|217980018|ref|YP_002364165.1| 30S ribosomal protein S20 [Methylocella silvestris BL2]
 gi|254813094|sp|B8EMX4|RS20_METSB RecName: Full=30S ribosomal protein S20
 gi|217505394|gb|ACK52803.1| ribosomal protein S20 [Methylocella silvestris BL2]
          Length = 88

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKI RRT +NKSRRS +R+++R   EAI  G  E AT+A R AE ++ +
Sbjct: 1  MANTPSAKKAVRKIERRTAVNKSRRSQMRTYVRKVEEAIASGDREAATQALRAAEPLVMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N ASRKVSRLS R+  +
Sbjct: 61 AAQKGIVHKNTASRKVSRLSARVSSL 86


>gi|114706657|ref|ZP_01439558.1| ribosomal protein S20 [Fulvimarina pelagi HTCC2506]
 gi|114538049|gb|EAU41172.1| ribosomal protein S20 [Fulvimarina pelagi HTCC2506]
          Length = 89

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 60/83 (72%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +N +RRS VR+F+R   EAI  G    ATEA R+AE  + +
Sbjct: 1  MANTPSAKKAARKIARRTAVNTARRSRVRTFLRRVEEAIASGDKNAATEAFRQAEPEMMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+FH N ASRK+SRL++R+
Sbjct: 61 ASSKGVFHKNTASRKISRLAQRV 83


>gi|220927408|ref|YP_002502710.1| 30S ribosomal protein S20 [Methylobacterium nodulans ORS 2060]
 gi|254813095|sp|B8IQW2|RS20_METNO RecName: Full=30S ribosomal protein S20
 gi|219952015|gb|ACL62407.1| ribosomal protein S20 [Methylobacterium nodulans ORS 2060]
          Length = 88

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKIA+RT IN+SRRS +R+FMR   EAI  G    A  A R AE  I +
Sbjct: 1  MANTVSAKKMTRKIAKRTAINRSRRSRMRTFMRKVEEAIASGDAANALAALRSAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N ASRKVSRL+ R+K +
Sbjct: 61 ASQKGIVHKNTASRKVSRLAARVKAL 86


>gi|319898308|ref|YP_004158401.1| 30S ribosomal protein S20 [Bartonella clarridgeiae 73]
 gi|319402272|emb|CBI75811.1| 30S ribosomal protein S20 [Bartonella clarridgeiae 73]
          Length = 88

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 61/86 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT INK+RRS VR+F+R  ++A+ FG  E A  A +  E  I +
Sbjct: 1  MANTPSAKKAVRKIAARTQINKARRSRVRTFIRKLDDALAFGDKEFAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVLHKNTAARKVSRLAKRLKAL 86


>gi|328545947|ref|YP_004306056.1| formamidopyrimidine-DNA glycosylase [polymorphum gilvum
          SL003B-26A1]
 gi|326415687|gb|ADZ72750.1| Formamidopyrimidine-DNA glycosylase, putative [Polymorphum gilvum
          SL003B-26A1]
          Length = 88

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT  NK+RRS VR+F+R   EAI  G    A+EA + A+  I +
Sbjct: 1  MANTPSAKKAARKIARRTATNKARRSRVRTFLRKVEEAIASGDQAAASEALKVAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AASKGVIHANTASRKVSRLNARVKAL 86


>gi|319405027|emb|CBI78637.1| 30S ribosomal protein S20 [Bartonella sp. AR 15-3]
          Length = 88

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 61/86 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT +NK+RRS VR+FMR  ++A+ +G    A  A +  E  I +
Sbjct: 1  MANTSSAKKAVRKIAVRTQVNKARRSRVRTFMRKLDDALAYGDKAFAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNTAARKVSRLAKRLKAL 86


>gi|222084649|ref|YP_002543178.1| ribosomal protein S20 [Agrobacterium radiobacter K84]
 gi|254813037|sp|B9J7T1|RS20_AGRRK RecName: Full=30S ribosomal protein S20
 gi|221722097|gb|ACM25253.1| ribosomal protein S20 [Agrobacterium radiobacter K84]
          Length = 91

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G    A EA   A+  + +
Sbjct: 1  MANTSSAKKATRKIARRTEVNKARRSRVRTFVRQVEEAIASGDATLAKEAFLAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL+KR+K +
Sbjct: 61 AATKGVLHANTASRKVSRLAKRVKAL 86


>gi|209551937|ref|YP_002283854.1| 30S ribosomal protein S20 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|241207320|ref|YP_002978416.1| 30S ribosomal protein S20 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|226695408|sp|B5ZYL1|RS20_RHILW RecName: Full=30S ribosomal protein S20
 gi|209537693|gb|ACI57628.1| ribosomal protein S20 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|240861210|gb|ACS58877.1| ribosomal protein S20 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 92

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G   +A EA   A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDAAKAKEAFLAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AASKGVLHANTASRKVSRLAARVKAL 86


>gi|190890025|ref|YP_001976567.1| 30S ribosomal protein S20 [Rhizobium etli CIAT 652]
 gi|218662590|ref|ZP_03518520.1| 30S ribosomal protein S20 [Rhizobium etli IE4771]
 gi|226695407|sp|B3PZ95|RS20_RHIE6 RecName: Full=30S ribosomal protein S20
 gi|190695304|gb|ACE89389.1| 30S ribosomal protein S20 [Rhizobium etli CIAT 652]
          Length = 92

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G  ++A  A   A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDADKAKAAFLAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A SKG+ H N ASRKVSRL+ R+K +  SA
Sbjct: 61 AASKGVLHSNTASRKVSRLAARVKALSVSA 90


>gi|116250143|ref|YP_765981.1| 30S ribosomal protein S20 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|118573834|sp|Q1MMD7|RS20_RHIL3 RecName: Full=30S ribosomal protein S20
 gi|115254791|emb|CAK05865.1| putative 30S ribosomal protein S20 [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 92

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G   +A EA   A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDAAKAKEAFLAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AASKGVLHSNTASRKVSRLAARVKAL 86


>gi|218507827|ref|ZP_03505705.1| 30S ribosomal protein S20 [Rhizobium etli Brasil 5]
 gi|218672090|ref|ZP_03521759.1| 30S ribosomal protein S20 [Rhizobium etli GR56]
          Length = 101

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G  ++A  A   A+  + +
Sbjct: 10 MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDADKAKAAFLAAQPELAR 69

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A SKG+ H N ASRKVSRL+ R+K +  SA
Sbjct: 70 AASKGVLHSNTASRKVSRLAARVKALSVSA 99


>gi|114571616|ref|YP_758296.1| 30S ribosomal protein S20P [Maricaulis maris MCS10]
 gi|122314864|sp|Q0AK35|RS20_MARMM RecName: Full=30S ribosomal protein S20
 gi|114342078|gb|ABI67358.1| SSU ribosomal protein S20P [Maricaulis maris MCS10]
          Length = 88

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 61/86 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN +SAKKM+RKIARRT +NK+RRS VR+F++    AIT G    A  A  +AES + +
Sbjct: 1  MANTNSAKKMVRKIARRTAVNKARRSRVRTFVKKVEMAITSGDQAAAKTALVEAESELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG++H N  SRKVSRLS R+K +
Sbjct: 61 AVGKGVYHKNTGSRKVSRLSARVKSM 86


>gi|86356014|ref|YP_467906.1| 30S ribosomal protein S20 [Rhizobium etli CFN 42]
 gi|118573833|sp|Q2KDA7|RS20_RHIEC RecName: Full=30S ribosomal protein S20
 gi|86280116|gb|ABC89179.1| 30S ribosomal protein S20 [Rhizobium etli CFN 42]
          Length = 92

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 60/89 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G  ++A  A   A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDADKAKAAFLAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H N ASRKVSRL+ R+K +  S
Sbjct: 61 AASKGVLHSNTASRKVSRLAARVKALSVS 89


>gi|170744975|ref|YP_001773630.1| 30S ribosomal protein S20 [Methylobacterium sp. 4-46]
 gi|226736522|sp|B0ULZ9|RS20_METS4 RecName: Full=30S ribosomal protein S20
 gi|168199249|gb|ACA21196.1| ribosomal protein S20 [Methylobacterium sp. 4-46]
          Length = 88

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 57/86 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKIA+RT IN+SRRS +R+F+R   EAI  G    A  A R AE  I +
Sbjct: 1  MANTVSAKKMTRKIAKRTAINRSRRSRMRTFIRKVEEAIASGDAATALTALRSAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N ASRKVSRL+ R+  +
Sbjct: 61 ASQKGIVHKNTASRKVSRLTARVNAL 86


>gi|83944869|ref|ZP_00957235.1| 30S ribosomal protein S20 [Oceanicaulis alexandrii HTCC2633]
 gi|83851651|gb|EAP89506.1| 30S ribosomal protein S20 [Oceanicaulis alexandrii HTCC2633]
          Length = 89

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 62/89 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKI RRT +NK+RR+ +R++++  + AI  G  ++A  A R AES + K
Sbjct: 1  MANTSSAKKMARKIERRTALNKARRTRMRTYVKKVDAAIATGDQDQARAALRTAESELMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H NA +RKVSRLS R+K +  S
Sbjct: 61 AVSKGVIHKNAGARKVSRLSARVKSMTAS 89


>gi|163854286|ref|YP_001642329.1| ribosomal protein S20 [Methylobacterium extorquens PA1]
 gi|218528083|ref|YP_002418899.1| 30S ribosomal protein S20 [Methylobacterium chloromethanicum CM4]
 gi|240141740|ref|YP_002966220.1| 30S ribosomal protein S20 [Methylobacterium extorquens AM1]
 gi|254564252|ref|YP_003071347.1| 30S ribosomal protein S20 [Methylobacterium extorquens DM4]
 gi|226736518|sp|A9W9L9|RS20_METEP RecName: Full=30S ribosomal protein S20
 gi|254813096|sp|B7KZZ9|RS20_METC4 RecName: Full=30S ribosomal protein S20
 gi|163665891|gb|ABY33258.1| ribosomal protein S20 [Methylobacterium extorquens PA1]
 gi|218520386|gb|ACK80971.1| ribosomal protein S20 [Methylobacterium chloromethanicum CM4]
 gi|240011717|gb|ACS42943.1| 30S ribosomal protein S20 [Methylobacterium extorquens AM1]
 gi|254271530|emb|CAX27545.1| 30S ribosomal protein S20 [Methylobacterium extorquens DM4]
          Length = 88

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKIA+RT IN+SRRS +R+F+R   EAI  G   +A  A R AE  I +
Sbjct: 1  MANTVSAKKMTRKIAKRTAINRSRRSRMRTFVRKVEEAIASGDQGQALTALRAAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   GI H N ASRKVSRL+ R+K I
Sbjct: 61 AAQNGIVHKNNASRKVSRLAARVKAI 86


>gi|307942714|ref|ZP_07658059.1| ribosomal protein S20 [Roseibium sp. TrichSKD4]
 gi|307773510|gb|EFO32726.1| ribosomal protein S20 [Roseibium sp. TrichSKD4]
          Length = 88

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIAR+T  NK+RRS VR+++R   EAI  G    A +A + A+  I +
Sbjct: 1  MANTPSAKKAARKIARQTATNKNRRSRVRTYLRKVEEAIASGDQTAANDALKSAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AASKGVMHANTASRKVSRLNARIKAL 86


>gi|114800507|ref|YP_759294.1| 30S ribosomal protein S20 [Hyphomonas neptunium ATCC 15444]
 gi|122942730|sp|Q0C4P9|RS20_HYPNA RecName: Full=30S ribosomal protein S20
 gi|114740681|gb|ABI78806.1| ribosomal protein S20 [Hyphomonas neptunium ATCC 15444]
          Length = 87

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKIA RT +NK+RRS VR+++R   EAI  G    A EA + A+  I +
Sbjct: 1  MANTRSAKKMVRKIAARTDVNKARRSRVRTYVRKVEEAIASGDKPAAQEALKAAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + +KG+ H N ASRKVSRLS R+K +
Sbjct: 61 SVTKGVTHKNTASRKVSRLSARVKAM 86


>gi|170746451|ref|YP_001752711.1| ribosomal protein S20 [Methylobacterium radiotolerans JCM 2831]
 gi|226736521|sp|B1M565|RS20_METRJ RecName: Full=30S ribosomal protein S20
 gi|170652973|gb|ACB22028.1| ribosomal protein S20 [Methylobacterium radiotolerans JCM 2831]
          Length = 88

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKIA+RT IN+SRRS +R+F+R   EAI  G  ++A  A R AE  + +
Sbjct: 1  MANTASAKKMTRKIAKRTAINRSRRSRMRTFVRKVEEAIASGNQQDALAALRAAEPEMMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   GI H N ASRKVSRL+ R+K +
Sbjct: 61 AAQHGIVHKNNASRKVSRLAARVKAL 86


>gi|49474935|ref|YP_032976.1| 30S ribosomal protein S20 [Bartonella henselae str. Houston-1]
 gi|59798707|sp|Q6G527|RS20_BARHE RecName: Full=30S ribosomal protein S20
 gi|49237740|emb|CAF26932.1| 30S ribosomal protein s20 [Bartonella henselae str. Houston-1]
          Length = 88

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K +RK+A RT +N++RRS VR+FMR  ++A+  G    A  A +  E  I +
Sbjct: 1  MANTPSAQKAVRKVAARTQVNRARRSRVRTFMRKFDDALAGGDRASAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH NAA+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNAAARKVSRLAKRLKAL 86


>gi|188579287|ref|YP_001922732.1| 30S ribosomal protein S20 [Methylobacterium populi BJ001]
 gi|226736520|sp|B1ZE36|RS20_METPB RecName: Full=30S ribosomal protein S20
 gi|179342785|gb|ACB78197.1| ribosomal protein S20 [Methylobacterium populi BJ001]
          Length = 88

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM RKIA+RT IN+SRRS +R+F+R   EAI  G   +A  A R AE  I +
Sbjct: 1  MANTVSAKKMTRKIAKRTAINRSRRSRMRTFVRKVEEAIATGDQGQALAALRVAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   GI H N ASRKVSRL+ R+K I
Sbjct: 61 AAQHGIVHKNNASRKVSRLAARVKAI 86


>gi|121602324|ref|YP_989530.1| 30S ribosomal protein S20 [Bartonella bacilliformis KC583]
 gi|166223212|sp|A1UU77|RS20_BARBK RecName: Full=30S ribosomal protein S20
 gi|120614501|gb|ABM45102.1| ribosomal protein S20 [Bartonella bacilliformis KC583]
          Length = 88

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK + KIA+RT +NK+RRS VR+F+R  N+A+  G    A  A R  E  I +
Sbjct: 1  MANTPSAKKAVNKIAKRTQVNKARRSRVRTFIRKFNDALAGGDKASAETAFRNCEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RKVSRL KRLK I
Sbjct: 61 AVSKGVLHKNTAARKVSRLVKRLKAI 86


>gi|312116359|ref|YP_004013955.1| ribosomal protein S20 [Rhodomicrobium vannielii ATCC 17100]
 gi|311221488|gb|ADP72856.1| ribosomal protein S20 [Rhodomicrobium vannielii ATCC 17100]
          Length = 90

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  RRTL+NK+R+S VR+F+R   EAI  G  E A  A R+A+  I +
Sbjct: 1  MANTKSAKKAARQAERRTLVNKARKSRVRTFVRKVEEAIASGDKEAANLALREAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKGI H N ASRK+SRLS R+K +
Sbjct: 61 SASKGILHKNTASRKISRLSARIKAL 86


>gi|163867414|ref|YP_001608611.1| 30S ribosomal protein S20 [Bartonella tribocorum CIP 105476]
 gi|189044849|sp|A9ILY6|RS20_BART1 RecName: Full=30S ribosomal protein S20
 gi|161017058|emb|CAK00616.1| 30S ribosomal protein S20 [Bartonella tribocorum CIP 105476]
          Length = 88

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K +RK+A RT +NK+RRS VR+FMR  ++A+  G    A  A +  E  I +
Sbjct: 1  MANTPSARKAVRKVAARTQVNKARRSRVRTFMRKFDDALAGGDKASAEIAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNTAARKVSRLAKRLKAL 86


>gi|153007347|ref|YP_001368562.1| 30S ribosomal protein S20 [Ochrobactrum anthropi ATCC 49188]
 gi|166223959|sp|A6WUS9|RS20_OCHA4 RecName: Full=30S ribosomal protein S20
 gi|151559235|gb|ABS12733.1| ribosomal protein S20 [Ochrobactrum anthropi ATCC 49188]
          Length = 88

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT INKSRRS VR+F+R   +A+  G  + A  A + AE  + +
Sbjct: 1  MANTPSAKKAVRKIAARTEINKSRRSRVRTFVRKLEDALLSGDKQAAEVAFKAAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRKVSRL++R+K +
Sbjct: 61 AASKGVMHKNTASRKVSRLAQRVKAL 86


>gi|319406514|emb|CBI80156.1| 30S ribosomal protein S20 [Bartonella sp. 1-1C]
          Length = 88

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT  NK+RRS VR+F+R  ++A+  G    A  A +  E  I +
Sbjct: 1  MANTPSAKKAVRKIAMRTQFNKARRSRVRTFIRKLDDALACGDKALAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNTAARKVSRLAKRLKAL 86


>gi|240849788|ref|YP_002971176.1| 30S ribosomal protein S20 [Bartonella grahamii as4aup]
 gi|240266911|gb|ACS50499.1| 30S ribosomal protein S20 [Bartonella grahamii as4aup]
          Length = 88

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K +RK+A RT +N++RRS VR+F+R  ++A+  G    A  A +  E  I +
Sbjct: 1  MANTPSARKAVRKVAARTQVNRARRSRVRTFIRKFDDALAGGDKASAEIAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH NAA+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNAAARKVSRLAKRLKAL 86


>gi|239830845|ref|ZP_04679174.1| ribosomal protein S20 [Ochrobactrum intermedium LMG 3301]
 gi|239823112|gb|EEQ94680.1| ribosomal protein S20 [Ochrobactrum intermedium LMG 3301]
          Length = 88

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT INKSRRS VR+F+R   +A+  G  + A  A + AE  + +
Sbjct: 1  MANTPSAKKAVRKIAARTEINKSRRSRVRTFVRKLEDALLSGDKQAAELAFKAAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AASKGVMHKNTASRKVSRLAHRVKAL 86


>gi|319403600|emb|CBI77185.1| 30S ribosomal protein S20 [Bartonella rochalimae ATCC BAA-1498]
          Length = 88

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT  NK+RRS +R+F+R  ++A+  G    A  A +  E  I +
Sbjct: 1  MANTPSAKKAVRKIAMRTQFNKARRSRIRTFIRKLDDALACGDKALAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNTAARKVSRLAKRLKAL 86


>gi|49473787|ref|YP_031829.1| 30S ribosomal protein S20 [Bartonella quintana str. Toulouse]
 gi|59798703|sp|Q6G0V7|RS20_BARQU RecName: Full=30S ribosomal protein S20
 gi|49239290|emb|CAF25616.1| 30s ribosomal protein s20 [Bartonella quintana str. Toulouse]
          Length = 88

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K +RK+A RT IN++RRS VR+FMR   +A+  G    A  A +  E  I +
Sbjct: 1  MANTPSAQKAVRKVAARTQINRARRSRVRAFMRKFYDALAGGDKVSAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH N A+RKVSRL+KRLK +
Sbjct: 61 AVSKGVFHKNTAARKVSRLAKRLKAL 86


>gi|182677003|ref|YP_001831149.1| 30S ribosomal protein S20 [Beijerinckia indica subsp. indica ATCC
          9039]
 gi|226735299|sp|B2IAW0|RS20_BEII9 RecName: Full=30S ribosomal protein S20
 gi|182632886|gb|ACB93660.1| ribosomal protein S20 [Beijerinckia indica subsp. indica ATCC
          9039]
          Length = 87

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/86 (55%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKI RRT INKSRRS +R+++R   EAI  G    AT A + A  ++ +
Sbjct: 1  MANTPSAKKAVRKIERRTAINKSRRSQMRTYIRKVEEAIASGDAAAATSALQSAAPLVMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N ASRKVSRLSKR+K +
Sbjct: 61 AAQKGIVHKNTASRKVSRLSKRVKAL 86


>gi|148558892|ref|YP_001259979.1| 30S ribosomal protein S20 [Brucella ovis ATCC 25840]
 gi|225626551|ref|ZP_03784590.1| ribosomal protein S20 [Brucella ceti str. Cudo]
 gi|237816524|ref|ZP_04595517.1| ribosomal protein S20 [Brucella abortus str. 2308 A]
 gi|148370149|gb|ABQ60128.1| ribosomal protein S20 [Brucella ovis ATCC 25840]
 gi|225618208|gb|EEH15251.1| ribosomal protein S20 [Brucella ceti str. Cudo]
 gi|237788591|gb|EEP62806.1| ribosomal protein S20 [Brucella abortus str. 2308 A]
          Length = 105

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SAKK +RKIA RT INKSRRS VR+F+R   +A+  G  + A  A +  E  + +
Sbjct: 18  MANTPSAKKAVRKIAARTEINKSRRSRVRTFVRKLEDALLSGDKQAAEVAFKAVEPELMR 77

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A SKG+ H N A+RKVSRL+KR+K +
Sbjct: 78  AASKGVVHKNTAARKVSRLAKRVKAL 103


>gi|295691598|ref|YP_003595291.1| 30S ribosomal protein S20 [Caulobacter segnis ATCC 21756]
 gi|295433501|gb|ADG12673.1| ribosomal protein S20 [Caulobacter segnis ATCC 21756]
          Length = 91

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 57/84 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IRKIARRT +N +RRS VR+F+R   EAI  G +  A  A  +A+S + +
Sbjct: 1  MANNPGAKKAIRKIARRTEVNTARRSRVRTFLRKFEEAIAKGDVAVAKAAFVEAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A SKG+ H N  SRKVSRL+ RLK
Sbjct: 61 AVSKGVVHPNTGSRKVSRLAARLK 84


>gi|17988227|ref|NP_540861.1| 30S ribosomal protein S20 [Brucella melitensis bv. 1 str. 16M]
 gi|23503032|ref|NP_699159.1| 30S ribosomal protein S20 [Brucella suis 1330]
 gi|62291021|ref|YP_222814.1| 30S ribosomal protein S20 [Brucella abortus bv. 1 str. 9-941]
 gi|82700932|ref|YP_415506.1| 30S ribosomal protein S20 [Brucella melitensis biovar Abortus
          2308]
 gi|161620093|ref|YP_001593980.1| 30S ribosomal protein S20 [Brucella canis ATCC 23365]
 gi|163844197|ref|YP_001628602.1| 30S ribosomal protein S20 [Brucella suis ATCC 23445]
 gi|189025235|ref|YP_001936003.1| 30S ribosomal protein S20 [Brucella abortus S19]
 gi|225853610|ref|YP_002733843.1| 30S ribosomal protein S20 [Brucella melitensis ATCC 23457]
 gi|254690317|ref|ZP_05153571.1| 30S ribosomal protein S20 [Brucella abortus bv. 6 str. 870]
 gi|254694805|ref|ZP_05156633.1| 30S ribosomal protein S20 [Brucella abortus bv. 3 str. Tulya]
 gi|254696434|ref|ZP_05158262.1| 30S ribosomal protein S20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700817|ref|ZP_05162645.1| 30S ribosomal protein S20 [Brucella suis bv. 5 str. 513]
 gi|254705184|ref|ZP_05167012.1| 30S ribosomal protein S20 [Brucella suis bv. 3 str. 686]
 gi|254707299|ref|ZP_05169127.1| 30S ribosomal protein S20 [Brucella pinnipedialis M163/99/10]
 gi|254709161|ref|ZP_05170972.1| 30S ribosomal protein S20 [Brucella pinnipedialis B2/94]
 gi|254713415|ref|ZP_05175226.1| 30S ribosomal protein S20 [Brucella ceti M644/93/1]
 gi|254716228|ref|ZP_05178039.1| 30S ribosomal protein S20 [Brucella ceti M13/05/1]
 gi|254718224|ref|ZP_05180035.1| 30S ribosomal protein S20 [Brucella sp. 83/13]
 gi|254731346|ref|ZP_05189924.1| 30S ribosomal protein S20 [Brucella abortus bv. 4 str. 292]
 gi|256030685|ref|ZP_05444299.1| 30S ribosomal protein S20 [Brucella pinnipedialis M292/94/1]
 gi|256045790|ref|ZP_05448668.1| 30S ribosomal protein S20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060144|ref|ZP_05450326.1| 30S ribosomal protein S20 [Brucella neotomae 5K33]
 gi|256112509|ref|ZP_05453430.1| 30S ribosomal protein S20 [Brucella melitensis bv. 3 str. Ether]
 gi|256158686|ref|ZP_05456569.1| 30S ribosomal protein S20 [Brucella ceti M490/95/1]
 gi|256254090|ref|ZP_05459626.1| 30S ribosomal protein S20 [Brucella ceti B1/94]
 gi|256258570|ref|ZP_05464106.1| 30S ribosomal protein S20 [Brucella abortus bv. 9 str. C68]
 gi|256264946|ref|ZP_05467478.1| ribosomal protein S20 [Brucella melitensis bv. 2 str. 63/9]
 gi|256370580|ref|YP_003108091.1| 30S ribosomal protein S20 [Brucella microti CCM 4915]
 gi|260169589|ref|ZP_05756400.1| 30S ribosomal protein S20 [Brucella sp. F5/99]
 gi|260546285|ref|ZP_05822025.1| ribosomal protein S20 [Brucella abortus NCTC 8038]
 gi|260563083|ref|ZP_05833569.1| ribosomal protein S20 [Brucella melitensis bv. 1 str. 16M]
 gi|260567349|ref|ZP_05837819.1| ribosomal protein S20 [Brucella suis bv. 4 str. 40]
 gi|260755856|ref|ZP_05868204.1| SSU ribosomal protein S20P [Brucella abortus bv. 6 str. 870]
 gi|260759079|ref|ZP_05871427.1| SSU ribosomal protein S20P [Brucella abortus bv. 4 str. 292]
 gi|260760805|ref|ZP_05873148.1| SSU ribosomal protein S20P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884881|ref|ZP_05896495.1| SSU ribosomal protein S20P [Brucella abortus bv. 9 str. C68]
 gi|261215131|ref|ZP_05929412.1| SSU ribosomal protein S20P [Brucella abortus bv. 3 str. Tulya]
 gi|261218002|ref|ZP_05932283.1| SSU ribosomal protein S20P [Brucella ceti M13/05/1]
 gi|261221231|ref|ZP_05935512.1| SSU ribosomal protein S20P [Brucella ceti B1/94]
 gi|261314780|ref|ZP_05953977.1| SSU ribosomal protein S20P [Brucella pinnipedialis M163/99/10]
 gi|261316659|ref|ZP_05955856.1| SSU ribosomal protein S20P [Brucella pinnipedialis B2/94]
 gi|261321148|ref|ZP_05960345.1| SSU ribosomal protein S20P [Brucella ceti M644/93/1]
 gi|261324122|ref|ZP_05963319.1| SSU ribosomal protein S20P [Brucella neotomae 5K33]
 gi|261751324|ref|ZP_05995033.1| SSU ribosomal protein S20P [Brucella suis bv. 5 str. 513]
 gi|261755889|ref|ZP_05999598.1| SSU ribosomal protein S20P [Brucella suis bv. 3 str. 686]
 gi|261759116|ref|ZP_06002825.1| ribosomal protein S20 [Brucella sp. F5/99]
 gi|261883944|ref|ZP_06007983.1| 30S ribosomal protein S20 [Campylobacter fetus subsp. venerealis
          str. Azul-94]
 gi|265983180|ref|ZP_06095915.1| SSU ribosomal protein S20P [Brucella sp. 83/13]
 gi|265987731|ref|ZP_06100288.1| SSU ribosomal protein S20P [Brucella pinnipedialis M292/94/1]
 gi|265992205|ref|ZP_06104762.1| SSU ribosomal protein S20P [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993945|ref|ZP_06106502.1| SSU ribosomal protein S20P [Brucella melitensis bv. 3 str. Ether]
 gi|265997192|ref|ZP_06109749.1| SSU ribosomal protein S20P [Brucella ceti M490/95/1]
 gi|294851410|ref|ZP_06792083.1| 30S ribosomal protein S20 [Brucella sp. NVSL 07-0026]
 gi|297247408|ref|ZP_06931126.1| 30S ribosomal protein S20 [Brucella abortus bv. 5 str. B3196]
 gi|306839964|ref|ZP_07472758.1| ribosomal protein S20 [Brucella sp. NF 2653]
 gi|306842705|ref|ZP_07475348.1| ribosomal protein S20 [Brucella sp. BO2]
 gi|306843602|ref|ZP_07476203.1| ribosomal protein S20 [Brucella sp. BO1]
 gi|54039469|sp|P66502|RS20_BRUSU RecName: Full=30S ribosomal protein S20
 gi|54042161|sp|P66501|RS20_BRUME RecName: Full=30S ribosomal protein S20
 gi|75496002|sp|Q57A81|RS20_BRUAB RecName: Full=30S ribosomal protein S20
 gi|115305672|sp|Q2YQP6|RS20_BRUA2 RecName: Full=30S ribosomal protein S20
 gi|189044850|sp|A9MAB4|RS20_BRUC2 RecName: Full=30S ribosomal protein S20
 gi|189044851|sp|B0CK30|RS20_BRUSI RecName: Full=30S ribosomal protein S20
 gi|226735304|sp|B2S9T4|RS20_BRUA1 RecName: Full=30S ribosomal protein S20
 gi|254813051|sp|C0RG67|RS20_BRUMB RecName: Full=30S ribosomal protein S20
 gi|17983993|gb|AAL53125.1| ssu ribosomal protein s20p [Brucella melitensis bv. 1 str. 16M]
 gi|23349074|gb|AAN31074.1| ribosomal protein S20 [Brucella suis 1330]
 gi|62197153|gb|AAX75453.1| RpsT, ribosomal protein S20 [Brucella abortus bv. 1 str. 9-941]
 gi|82617033|emb|CAJ12142.1| Ribosomal protein S20 [Brucella melitensis biovar Abortus 2308]
 gi|161336904|gb|ABX63209.1| ribosomal protein S20 [Brucella canis ATCC 23365]
 gi|163674920|gb|ABY39031.1| ribosomal protein S20 [Brucella suis ATCC 23445]
 gi|189020807|gb|ACD73529.1| Ribosomal protein S20 [Brucella abortus S19]
 gi|225641975|gb|ACO01889.1| ribosomal protein S20 [Brucella melitensis ATCC 23457]
 gi|256000743|gb|ACU49142.1| 30S ribosomal protein S20 [Brucella microti CCM 4915]
 gi|260096392|gb|EEW80268.1| ribosomal protein S20 [Brucella abortus NCTC 8038]
 gi|260153099|gb|EEW88191.1| ribosomal protein S20 [Brucella melitensis bv. 1 str. 16M]
 gi|260156867|gb|EEW91947.1| ribosomal protein S20 [Brucella suis bv. 4 str. 40]
 gi|260669397|gb|EEX56337.1| SSU ribosomal protein S20P [Brucella abortus bv. 4 str. 292]
 gi|260671237|gb|EEX58058.1| SSU ribosomal protein S20P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675964|gb|EEX62785.1| SSU ribosomal protein S20P [Brucella abortus bv. 6 str. 870]
 gi|260874409|gb|EEX81478.1| SSU ribosomal protein S20P [Brucella abortus bv. 9 str. C68]
 gi|260916738|gb|EEX83599.1| SSU ribosomal protein S20P [Brucella abortus bv. 3 str. Tulya]
 gi|260919815|gb|EEX86468.1| SSU ribosomal protein S20P [Brucella ceti B1/94]
 gi|260923091|gb|EEX89659.1| SSU ribosomal protein S20P [Brucella ceti M13/05/1]
 gi|261293838|gb|EEX97334.1| SSU ribosomal protein S20P [Brucella ceti M644/93/1]
 gi|261295882|gb|EEX99378.1| SSU ribosomal protein S20P [Brucella pinnipedialis B2/94]
 gi|261300102|gb|EEY03599.1| SSU ribosomal protein S20P [Brucella neotomae 5K33]
 gi|261303806|gb|EEY07303.1| SSU ribosomal protein S20P [Brucella pinnipedialis M163/99/10]
 gi|261739100|gb|EEY27096.1| ribosomal protein S20 [Brucella sp. F5/99]
 gi|261741077|gb|EEY29003.1| SSU ribosomal protein S20P [Brucella suis bv. 5 str. 513]
 gi|261745642|gb|EEY33568.1| SSU ribosomal protein S20P [Brucella suis bv. 3 str. 686]
 gi|262551660|gb|EEZ07650.1| SSU ribosomal protein S20P [Brucella ceti M490/95/1]
 gi|262764926|gb|EEZ10847.1| SSU ribosomal protein S20P [Brucella melitensis bv. 3 str. Ether]
 gi|263003271|gb|EEZ15564.1| SSU ribosomal protein S20P [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095430|gb|EEZ19031.1| ribosomal protein S20 [Brucella melitensis bv. 2 str. 63/9]
 gi|264659928|gb|EEZ30189.1| SSU ribosomal protein S20P [Brucella pinnipedialis M292/94/1]
 gi|264661772|gb|EEZ32033.1| SSU ribosomal protein S20P [Brucella sp. 83/13]
 gi|294819999|gb|EFG36998.1| 30S ribosomal protein S20 [Brucella sp. NVSL 07-0026]
 gi|297174577|gb|EFH33924.1| 30S ribosomal protein S20 [Brucella abortus bv. 5 str. B3196]
 gi|306276293|gb|EFM57993.1| ribosomal protein S20 [Brucella sp. BO1]
 gi|306287151|gb|EFM58653.1| ribosomal protein S20 [Brucella sp. BO2]
 gi|306404928|gb|EFM61213.1| ribosomal protein S20 [Brucella sp. NF 2653]
 gi|326410184|gb|ADZ67249.1| Ribosomal protein S20 [Brucella melitensis M28]
 gi|326539902|gb|ADZ88117.1| ribosomal protein S20 [Brucella melitensis M5-90]
          Length = 88

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT INKSRRS VR+F+R   +A+  G  + A  A +  E  + +
Sbjct: 1  MANTPSAKKAVRKIAARTEINKSRRSRVRTFVRKLEDALLSGDKQAAEVAFKAVEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RKVSRL+KR+K +
Sbjct: 61 AASKGVVHKNTAARKVSRLAKRVKAL 86


>gi|227824217|ref|YP_002828190.1| 30S ribosomal protein S20 [Sinorhizobium fredii NGR234]
 gi|254813088|sp|C3MCY9|RS20_RHISN RecName: Full=30S ribosomal protein S20
 gi|227343219|gb|ACP27437.1| 30S ribosomal protein S20 [Sinorhizobium fredii NGR234]
          Length = 88

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTAVNKARRSRVRTFVRQVEEAIASGDQAAAAAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL++R+K +
Sbjct: 61 AATKGVVHANTASRKVSRLAQRVKAL 86


>gi|221232946|ref|YP_002515382.1| 30S ribosomal protein S20 [Caulobacter crescentus NA1000]
 gi|220962118|gb|ACL93474.1| SSU ribosomal protein S20P [Caulobacter crescentus NA1000]
          Length = 96

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IRKIARRT +N +RRS VR+F+R   +AI  G +  A  A  +A+S + +
Sbjct: 6  MANNPGAKKAIRKIARRTEVNTARRSRVRTFLRKFEDAIAKGDVAVAKAAFVEAQSELMR 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N  SRKVSRL+ RLK +
Sbjct: 66 AVSKGVVHPNTGSRKVSRLAARLKKL 91


>gi|16124263|ref|NP_418827.1| 30S ribosomal protein S20 [Caulobacter crescentus CB15]
 gi|239977594|sp|P0CAW3|RS20_CAUCR RecName: Full=30S ribosomal protein S20
 gi|239977659|sp|B8GWW4|RS20_CAUCN RecName: Full=30S ribosomal protein S20
 gi|13421093|gb|AAK21995.1| ribosomal protein S20 [Caulobacter crescentus CB15]
          Length = 91

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 57/84 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IRKIARRT +N +RRS VR+F+R   +AI  G +  A  A  +A+S + +
Sbjct: 1  MANNPGAKKAIRKIARRTEVNTARRSRVRTFLRKFEDAIAKGDVAVAKAAFVEAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A SKG+ H N  SRKVSRL+ RLK
Sbjct: 61 AVSKGVVHPNTGSRKVSRLAARLK 84


>gi|154250457|ref|YP_001411281.1| 30S ribosomal protein S20 [Parvibaculum lavamentivorans DS-1]
 gi|171769412|sp|A7HNZ1|RS20_PARL1 RecName: Full=30S ribosomal protein S20
 gi|154154407|gb|ABS61624.1| ribosomal protein S20 [Parvibaculum lavamentivorans DS-1]
          Length = 87

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK IR IA++T +NK RRS +R+F+R   EA+  G    A EA R A+  I +
Sbjct: 1  MANTKSAKKAIRVIAKKTAVNKDRRSRMRTFVRKVEEALASGDKTAAQEALRAAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N ASRKVSR ++R+K +
Sbjct: 61 AAQKGVIHKNTASRKVSRFTQRVKAL 86


>gi|302384443|ref|YP_003820266.1| ribosomal protein S20 [Brevundimonas subvibrioides ATCC 15264]
 gi|302195071|gb|ADL02643.1| ribosomal protein S20 [Brevundimonas subvibrioides ATCC 15264]
          Length = 89

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 57/84 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IRKIA RT +NKSRR+ VR+F+R   EA+T G  E A  A  +A+S + +
Sbjct: 1  MANNPGAKKAIRKIAARTEVNKSRRTRVRTFLRKFQEAVTGGDAEAAKGAFVEAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A +KG+ H N  SRKVSRL  +LK
Sbjct: 61 AVTKGVVHKNTGSRKVSRLHAQLK 84


>gi|163757768|ref|ZP_02164857.1| 30S ribosomal protein S20 [Hoeflea phototrophica DFL-43]
 gi|162285270|gb|EDQ35552.1| 30S ribosomal protein S20 [Hoeflea phototrophica DFL-43]
          Length = 88

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT INK+RRS VR F+R   EAI+ G  + A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTEINKARRSRVRGFLRKVEEAISSGDKDAAAAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRK+SRLS R+K I
Sbjct: 61 AATKGVVHANTASRKISRLSNRVKAI 86


>gi|319407985|emb|CBI81639.1| 30S ribosomal protein S20 [Bartonella schoenbuchensis R1]
          Length = 88

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIA RT +NK+RRS VR+F+R  N+A+  G    A  A +  E  I +
Sbjct: 1  MANTLSAKKAVRKIAARTQVNKARRSRVRTFIRKFNDALASGDKASAEVAFKNFEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+FH N A+RKVS L+KRLK  
Sbjct: 61 AVSKGVFHKNTAARKVSCLAKRLKAF 86


>gi|304392444|ref|ZP_07374385.1| ribosomal protein S20 [Ahrensia sp. R2A130]
 gi|303295548|gb|EFL89907.1| ribosomal protein S20 [Ahrensia sp. R2A130]
          Length = 88

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIAR+T +NKSRR+ +R  +R   EAI  G    A E  +  + VI K
Sbjct: 1  MANTSSAKKATRKIARKTAVNKSRRTFMRGQLRLMEEAIAAGDQTAAAEQFKAVQPVIMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKGI H N ASRKVSRLS R+K +
Sbjct: 61 SASKGIIHKNTASRKVSRLSARVKAL 86


>gi|307301265|ref|ZP_07581027.1| ribosomal protein S20 [Sinorhizobium meliloti BL225C]
 gi|307317936|ref|ZP_07597373.1| ribosomal protein S20 [Sinorhizobium meliloti AK83]
 gi|306896338|gb|EFN27087.1| ribosomal protein S20 [Sinorhizobium meliloti AK83]
 gi|306903721|gb|EFN34308.1| ribosomal protein S20 [Sinorhizobium meliloti BL225C]
          Length = 88

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS +RSF+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTAVNKARRSRIRSFVRKVEEAIASGDQALAAAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL++R+K +
Sbjct: 61 AATKGVMHSNTASRKVSRLAQRVKSL 86


>gi|222147315|ref|YP_002548272.1| 30S ribosomal protein S20 [Agrobacterium vitis S4]
 gi|254813038|sp|B9JZF6|RS20_AGRVS RecName: Full=30S ribosomal protein S20
 gi|221734305|gb|ACM35268.1| 30S ribosomal protein S20 [Agrobacterium vitis S4]
          Length = 88

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT INKSRR+ VR+F+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTAINKSRRTRVRNFVRKVEEAIASGDQALAAAALKAAQPELHR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRK+SRL+ R+K +
Sbjct: 61 AASKGVVHANTASRKISRLASRVKAL 86


>gi|323137248|ref|ZP_08072327.1| ribosomal protein S20 [Methylocystis sp. ATCC 49242]
 gi|322397606|gb|EFY00129.1| ribosomal protein S20 [Methylocystis sp. ATCC 49242]
          Length = 90

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKI RRT +N++RRS +R+F+R   EA+  G    A++A + A   + +
Sbjct: 1  MANTSSAKKAVRKIERRTAVNRARRSRMRTFVRKVEEALAAGDATLASDALQNAVPEMMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AAQKGVIHKNTASRKVSRLTARVKAL 86


>gi|150395229|ref|YP_001325696.1| 30S ribosomal protein S20 [Sinorhizobium medicae WSM419]
 gi|166223990|sp|A6U5D1|RS20_SINMW RecName: Full=30S ribosomal protein S20
 gi|150026744|gb|ABR58861.1| ribosomal protein S20 [Sinorhizobium medicae WSM419]
          Length = 88

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRTAVNKARRSRVRNFVRKVEEAIASGDQAVAAAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL++R+K +
Sbjct: 61 AATKGVMHSNTASRKVSRLAQRVKSL 86


>gi|298290592|ref|YP_003692531.1| ribosomal protein S20 [Starkeya novella DSM 506]
 gi|296927103|gb|ADH87912.1| ribosomal protein S20 [Starkeya novella DSM 506]
          Length = 88

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 55/83 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKI RRT +NK+RRS +R+F+R   EAI  G    A  A + AE  I +
Sbjct: 1  MANTPSAKKAARKIERRTEVNKNRRSRMRTFVRKIEEAIASGDRTAADVAFKAAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H N ASRKVSRL++RL
Sbjct: 61 AAQKGVLHKNTASRKVSRLAQRL 83


>gi|88608241|ref|YP_506667.1| ribosomal protein S20 [Neorickettsia sennetsu str. Miyayama]
 gi|115305692|sp|Q2GCX9|RS20_NEOSM RecName: Full=30S ribosomal protein S20
 gi|88600410|gb|ABD45878.1| ribosomal protein S20 [Neorickettsia sennetsu str. Miyayama]
          Length = 87

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKI RRTL+NK R S +R+F+R   +AI  G    A EA R A+  I +
Sbjct: 1  MANTASAKKMVRKIKRRTLVNKMRMSRIRTFVRKVRKAIAVGPKSAAAEALRVAQPEIHR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +KG+ H N A+R VSRLS  +K
Sbjct: 61 GVTKGVLHKNRAARIVSRLSGHIK 84


>gi|254797130|ref|YP_003081968.1| ribosomal protein S20 [Neorickettsia risticii str. Illinois]
 gi|254590360|gb|ACT69722.1| ribosomal protein S20 [Neorickettsia risticii str. Illinois]
          Length = 87

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 54/84 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKI RRTL+NK R S +R+F+R    AI  G    A EA R A+  I +
Sbjct: 1  MANTASAKKMVRKIKRRTLVNKMRMSRIRTFVRKVKNAIAVGPKSAAAEALRIAQPEIHR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +KG+ H N A+R VSRLS  +K
Sbjct: 61 GVTKGVLHKNRAARIVSRLSGHIK 84


>gi|260461960|ref|ZP_05810205.1| ribosomal protein S20 [Mesorhizobium opportunistum WSM2075]
 gi|259032207|gb|EEW33473.1| ribosomal protein S20 [Mesorhizobium opportunistum WSM2075]
          Length = 88

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 57/84 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARR  INK+RRS VR+++R   EA+  G    A  A + AE  + +
Sbjct: 1  MANTSSAKKATRKIARRAEINKNRRSRVRTYVRQVEEALASGDKAAAQAAFKAAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A +KGI H N ASRKVSRL++RLK
Sbjct: 61 AATKGIIHKNTASRKVSRLAQRLK 84


>gi|15964120|ref|NP_384473.1| 30S ribosomal protein S20 [Sinorhizobium meliloti 1021]
 gi|7404467|sp|P48948|RS20_RHIME RecName: Full=30S ribosomal protein S20
 gi|15073296|emb|CAC41804.1| 30S ribosomal protein S20 [Sinorhizobium meliloti 1021]
          Length = 88

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARR+ +NK+RRS +RSF+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRSAVNKARRSRIRSFVRKVEEAIASGDQALAAAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL++R+K +
Sbjct: 61 AATKGVMHSNTASRKVSRLAQRVKSL 86


>gi|197106891|ref|YP_002132268.1| 30S ribosomal protein S20 [Phenylobacterium zucineum HLK1]
 gi|226695397|sp|B4RC46|RS20_PHEZH RecName: Full=30S ribosomal protein S20
 gi|196480311|gb|ACG79839.1| 30S ribosomal protein S20 [Phenylobacterium zucineum HLK1]
          Length = 89

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK +RKIARRT +N +RRS VR+F+R   EA+  G    A  A  +A+S + +
Sbjct: 1  MANTPGAKKAVRKIARRTEVNTARRSRVRTFLRKFEEALASGDAGAAKAAFVQAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A SKG+ H N  +RKVSRL+ RLK
Sbjct: 61 AVSKGVVHKNTGARKVSRLAARLK 84


>gi|119387219|ref|YP_918274.1| 30S ribosomal protein S20 [Paracoccus denitrificans PD1222]
 gi|166223962|sp|A1BAN4|RS20_PARDP RecName: Full=30S ribosomal protein S20
 gi|119377814|gb|ABL72578.1| SSU ribosomal protein S20P [Paracoccus denitrificans PD1222]
          Length = 89

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 58/89 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R++ RRT +NK+RRS +R+F+R   EAI  G  E A EA   A+  + +
Sbjct: 1  MANTPQSKKRARQLERRTAVNKARRSRIRTFLRKVEEAIASGNAEIAREALNSAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+ H N A+RK+SRLS R+K + T+
Sbjct: 61 GVTKGVIHKNTAARKMSRLSARVKALATA 89


>gi|329847537|ref|ZP_08262565.1| ribosomal protein S20 [Asticcacaulis biprosthecum C19]
 gi|328842600|gb|EGF92169.1| ribosomal protein S20 [Asticcacaulis biprosthecum C19]
          Length = 89

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K IRKIA RT +NK+RRS VR+++R   EA+T G    A  A  +A+S + +
Sbjct: 1  MANNPGARKSIRKIAARTEVNKARRSRVRTYVRKFEEALTAGDATVAQTAFVQAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H N  +RKVSRL+ +LK + T+
Sbjct: 61 AVSKGVVHKNTGARKVSRLAAQLKKLATA 89


>gi|329891036|ref|ZP_08269379.1| ribosomal protein S20 [Brevundimonas diminuta ATCC 11568]
 gi|328846337|gb|EGF95901.1| ribosomal protein S20 [Brevundimonas diminuta ATCC 11568]
          Length = 104

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K IRKI  RT +NK+RR+ VR+++R   EA+T G +E A  A   A+S + +
Sbjct: 16 MANNAGARKAIRKIEARTEVNKARRTRVRTYLRKFQEALTGGDVEAAKAAFITAQSELMR 75

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A SKG+ H N  SRKVSRL+ +LK
Sbjct: 76 AVSKGVVHKNTGSRKVSRLAAQLK 99


>gi|13474649|ref|NP_106218.1| 30S ribosomal protein S20 [Mesorhizobium loti MAFF303099]
 gi|17865584|sp|Q98BG8|RS20_RHILO RecName: Full=30S ribosomal protein S20
 gi|14025404|dbj|BAB52004.1| 30S ribosomal protein S20 [Mesorhizobium loti MAFF303099]
          Length = 88

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 56/84 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARR  INK+RRS VR+++R   EA+  G    A  A + AE  + +
Sbjct: 1  MANTSSAKKATRKIARRAAINKNRRSRVRTYVRQVEEALASGDKAAAQAAFKAAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A +KG+ H N ASRKVSRL+ RLK
Sbjct: 61 AATKGVIHKNTASRKVSRLAARLK 84


>gi|296448172|ref|ZP_06890070.1| ribosomal protein S20 [Methylosinus trichosporium OB3b]
 gi|296254303|gb|EFH01432.1| ribosomal protein S20 [Methylosinus trichosporium OB3b]
          Length = 88

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIARRT +N+SRRS +R+ +R   EAI  G    A    +    V+ +
Sbjct: 1  MANTSSAKKAVRKIARRTAVNRSRRSQLRTQVRKVEEAIASGDAAVAAAVLQSVAPVVMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   G+ H N ASRKVSRL+ R+K +
Sbjct: 61 AAQNGVIHKNTASRKVSRLTARVKAL 86


>gi|86751810|ref|YP_488306.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris HaA2]
 gi|118573836|sp|Q2IQW5|RS20_RHOP2 RecName: Full=30S ribosomal protein S20
 gi|86574838|gb|ABD09395.1| SSU ribosomal protein S20P [Rhodopseudomonas palustris HaA2]
          Length = 88

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NKSRR+ +R  +R   EAI  G  E A +A   AE  + +
Sbjct: 1  MANTSSAKKATRKIARRTAVNKSRRTQMRGSVRTVEEAIASGDREAALKAMANAEPALMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H NAASRKVSRL+ R+
Sbjct: 61 AAQRNIVHKNAASRKVSRLAHRI 83


>gi|91978879|ref|YP_571538.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris BisB5]
 gi|123721484|sp|Q12ZV2|RS20_RHOPS RecName: Full=30S ribosomal protein S20
 gi|91685335|gb|ABE41637.1| SSU ribosomal protein S20P [Rhodopseudomonas palustris BisB5]
          Length = 88

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 54/83 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NKSRR+ +R  +R   EAI  G  + A +A   AE  + +
Sbjct: 1  MANTSSAKKATRKIARRTAVNKSRRTQMRGSVRTVEEAIASGDRDAAVKALANAEPALMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H NAASRKVSRL+ R+
Sbjct: 61 AAQRNIVHKNAASRKVSRLASRI 83


>gi|110636426|ref|YP_676634.1| SSU ribosomal protein S20P [Mesorhizobium sp. BNC1]
 gi|118573825|sp|Q11AV6|RS20_MESSB RecName: Full=30S ribosomal protein S20
 gi|110287410|gb|ABG65469.1| SSU ribosomal protein S20P [Chelativorans sp. BNC1]
          Length = 88

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKIARRT INK+RRS VR+++R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKAVRKIARRTAINKTRRSRVRTYVRKVEEAIASGDKGAAEAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++G+ H N A+RKVSRL++R+K +
Sbjct: 61 AATRGVLHKNTAARKVSRLARRVKTL 86


>gi|755068|gb|AAA91096.1| ribosomal protein S20 [Sinorhizobium meliloti]
          Length = 88

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARR+ +NK+RRS +RSF+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANTTSAKKATRKIARRSAVNKARRSRIRSFVRKVEEAIASGDQALAAAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N ASRKVSRL++R+K +
Sbjct: 61 PATKGVMHSNTASRKVSRLAQRVKSL 86


>gi|42520951|ref|NP_966866.1| 30S ribosomal protein S20 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|99034664|ref|ZP_01314608.1| hypothetical protein Wendoof_01000578 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|59798786|sp|Q73G18|RS20_WOLPM RecName: Full=30S ribosomal protein S20
 gi|42410692|gb|AAS14800.1| ribosomal protein S20 [Wolbachia endosymbiont of Drosophila
          melanogaster]
          Length = 89

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 60/89 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKMI+ IA+RTLINK R+S  R+ +R+  + I  G  E    A R AES + K
Sbjct: 1  MANHKSAKKMIKVIAKRTLINKMRKSKTRTAIRNLVDIIKSGDKENVVLAFRNAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+ H N A+RK+SRL+ ++K ++T+
Sbjct: 61 CVNKGVIHRNTAARKISRLNAKVKALMTA 89


>gi|159045911|ref|YP_001534705.1| 30S ribosomal protein S20 [Dinoroseobacter shibae DFL 12]
 gi|189044861|sp|A8LNL0|RS20_DINSH RecName: Full=30S ribosomal protein S20
 gi|157913671|gb|ABV95104.1| ribosomal protein S20 [Dinoroseobacter shibae DFL 12]
          Length = 88

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  RR  +NK+RRS +R+F+R   EAI  G    A +A R A+  + +
Sbjct: 1  MANSPQAKKRARQNERRAEVNKARRSRIRTFLRKVEEAIASGDSSAAADALRSAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGI H N ASRK+SRLSKR+K +
Sbjct: 61 GVTKGILHKNTASRKMSRLSKRVKAL 86


>gi|58584991|ref|YP_198564.1| 30S ribosomal protein S20 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
 gi|75497632|sp|Q5GRQ2|RS20_WOLTR RecName: Full=30S ribosomal protein S20
 gi|58419307|gb|AAW71322.1| Ribosomal protein S20 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
          Length = 89

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  + KKMI+ IA+RTLINK R+S  R+ +R   + I  G  E  T A R AES + K
Sbjct: 1  MVNHKNVKKMIKAIAKRTLINKMRKSKTRTAIRKLVDIIKSGNKENVTPAFRSAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            SKG+ H N A+RK+SRL+ ++K ++T+
Sbjct: 61 CVSKGVIHKNTAARKISRLNAKVKALMTA 89


>gi|158422639|ref|YP_001523931.1| 30S ribosomal protein S20 [Azorhizobium caulinodans ORS 571]
 gi|172047820|sp|A8HQ27|RS20_AZOC5 RecName: Full=30S ribosomal protein S20
 gi|158329528|dbj|BAF87013.1| ribosomal protein S20p [Azorhizobium caulinodans ORS 571]
          Length = 88

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKI RRT +N++RRS VR+++R   +A+T G  + A  A + AE  I +
Sbjct: 1  MANTPSAKKAARKIERRTAVNRARRSRVRTYLRKLEDALTAGNKDAAVAAFKAAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL+ R++ I
Sbjct: 61 AVTKGVLHKNTASRKVSRLAARVRKI 86


>gi|118590462|ref|ZP_01547864.1| 30s ribosomal protein s20 [Stappia aggregata IAM 12614]
 gi|118436925|gb|EAV43564.1| 30s ribosomal protein s20 [Stappia aggregata IAM 12614]
          Length = 88

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT  NK+RRS VR+++R   EAI  G    A EA + A+  I +
Sbjct: 1  MANTPSAKKAARKIARRTATNKARRSRVRTYLRKVEEAIASGDQAAANEAFKAAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG  H N ASRKVSRL+ R+K +
Sbjct: 61 AAGKGTMHANTASRKVSRLNARIKAL 86


>gi|304319872|ref|YP_003853515.1| hypothetical protein PB2503_01477 [Parvularcula bermudensis
          HTCC2503]
 gi|303298775|gb|ADM08374.1| hypothetical protein PB2503_01477 [Parvularcula bermudensis
          HTCC2503]
          Length = 88

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKI RRT +NKSRRS VR+F+R   EAI  G    A+ A  +A S +Q+
Sbjct: 1  MANTSSAKKMVRKIERRTAVNKSRRSRVRTFLRRVEEAIANGDAAAASSAFAEATSEVQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A S GI H N ASRK+SRLS R+K I
Sbjct: 61 AVSHGIIHKNTASRKLSRLSGRIKAI 86


>gi|225629722|ref|ZP_03787684.1| ribosomal protein S20 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|225591424|gb|EEH12502.1| ribosomal protein S20 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
          Length = 89

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKMI+ IA+RTLINK R+S  R+ +R   + I  G  E    A R AES + K
Sbjct: 1  MANHKSAKKMIKVIAKRTLINKMRKSKTRTAIRKLVDIIKSGDKENVVLAFRNAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+ H N A+RK+SRL+ ++K ++T+
Sbjct: 61 CVNKGVIHRNTAARKISRLNAKVKALMTA 89


>gi|316936312|ref|YP_004111294.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris DX-1]
 gi|315604026|gb|ADU46561.1| ribosomal protein S20 [Rhodopseudomonas palustris DX-1]
          Length = 88

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 53/80 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NKSRR+ +R  +R   EAI  G  E A +A  +AE  + +
Sbjct: 1  MANTSSAKKATRKIARRTAVNKSRRTQMRGSVRTVEEAIANGDREAALKAMARAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  + I H NAASRKVSRLS
Sbjct: 61 AAQRNIIHRNAASRKVSRLS 80


>gi|254295381|ref|YP_003061404.1| ribosomal protein S20 [Hirschia baltica ATCC 49814]
 gi|254043912|gb|ACT60707.1| ribosomal protein S20 [Hirschia baltica ATCC 49814]
          Length = 87

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 57/86 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM+RKI R+T +NK+RRS +R+F+R   EAI  G    A  A + A+  I +
Sbjct: 1  MANTSSAKKMVRKIERKTAVNKNRRSRMRTFIRRVEEAIAGGDQAAAQAALKAAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N  SRKVSRLS R+K +
Sbjct: 61 AVGKGILHRNTGSRKVSRLSSRVKAM 86


>gi|225630695|ref|YP_002727486.1| ribosomal protein S20 [Wolbachia sp. wRi]
 gi|254813075|sp|C0R453|RS20_WOLWR RecName: Full=30S ribosomal protein S20
 gi|225592676|gb|ACN95695.1| ribosomal protein S20 [Wolbachia sp. wRi]
          Length = 89

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKMI+ IA+RTLINK R+S  R+ +R   + I  G  E    A R AES + K
Sbjct: 1  MANHKSAKKMIKVIAKRTLINKMRKSKTRTSIRKLVDIIKSGDKENVVLAFRNAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+ H N A+RK+SRL+ ++K ++T+
Sbjct: 61 CVNKGVIHRNTAARKISRLNAKVKALMTA 89


>gi|319785619|ref|YP_004145095.1| ribosomal protein S20 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317171507|gb|ADV15045.1| ribosomal protein S20 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 88

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKI RR  INK+RRS VR+++R   EA+  G    A  A + AE  + +
Sbjct: 1  MANTSSAKKATRKIVRRAAINKNRRSRVRTYIRQVEEALASGDKAAAQAAFKIAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A +KG+ H N ASRKVSRL++R+K
Sbjct: 61 AATKGVIHKNTASRKVSRLAQRVK 84


>gi|126724503|ref|ZP_01740346.1| ribosomal protein S20 [Rhodobacterales bacterium HTCC2150]
 gi|126705667|gb|EBA04757.1| ribosomal protein S20 [Rhodobacterales bacterium HTCC2150]
          Length = 88

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  RRT +NK+RRS +R+F+R   EAIT G  E A  A + A+  + +
Sbjct: 1  MANTPQSKKRARQAERRTEVNKARRSRIRTFLRKVEEAITSGDQEVAKAALQAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVVHKNTASRKISRLASRVKAL 86


>gi|254453247|ref|ZP_05066684.1| ribosomal protein S20 [Octadecabacter antarcticus 238]
 gi|198267653|gb|EDY91923.1| ribosomal protein S20 [Octadecabacter antarcticus 238]
          Length = 100

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK+RRS +R+F+R A EAI  G+ + AT A R  +  + +
Sbjct: 14 MANTPQAKKRARQNEARFQVNKARRSRIRTFLRKAEEAIASGEKDAATAALRALQPELMR 73

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+FH N A+RK+SRLS R+K I
Sbjct: 74 GVSKGVFHKNTAARKMSRLSSRVKAI 99


>gi|115526908|ref|YP_783819.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris BisA53]
 gi|122294363|sp|Q07GU5|RS20_RHOP5 RecName: Full=30S ribosomal protein S20
 gi|115520855|gb|ABJ08839.1| SSU ribosomal protein S20P [Rhodopseudomonas palustris BisA53]
          Length = 88

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT++NKSRR+ +R  +R   EAI  G  + A +A  + E  + +
Sbjct: 1  MANTTSAKKATRKIARRTIVNKSRRTQMRGAVRTVEEAIAKGDRDAAVKAMTRCEPELMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H NAASRKVSRL++++
Sbjct: 61 AAQRNIIHRNAASRKVSRLTQKI 83


>gi|114769646|ref|ZP_01447256.1| ribosomal protein S20 [alpha proteobacterium HTCC2255]
 gi|114549351|gb|EAU52233.1| ribosomal protein S20 [alpha proteobacterium HTCC2255]
 gi|297184286|gb|ADI20403.1| hypothetical protein [uncultured alpha proteobacterium
          EB080_L43F08]
          Length = 88

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 56/87 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  RRT +NK+RRS +R+F+R   EAI  G    A EA +  +  + +
Sbjct: 1  MANTPQAKKRARQAERRTEVNKARRSRIRTFLRKTEEAIASGDQAVAKEAFKAVQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            +KG++H N  +RK+SRLS R+KG++
Sbjct: 61 GVTKGVYHKNTVARKLSRLSSRIKGLV 87


>gi|254440183|ref|ZP_05053677.1| ribosomal protein S20 [Octadecabacter antarcticus 307]
 gi|198255629|gb|EDY79943.1| ribosomal protein S20 [Octadecabacter antarcticus 307]
          Length = 87

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK+RRS +R+F+R A EAI  G+ + AT A R  +  + +
Sbjct: 1  MANTPQAKKRARQNESRFQVNKARRSRIRTFLRKAEEAIASGEKDAATAAVRALQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+FH N A+RK+SRLS R+K I
Sbjct: 61 GVSKGVFHKNTAARKMSRLSARVKSI 86


>gi|83950591|ref|ZP_00959324.1| ribosomal protein S20 [Roseovarius nubinhibens ISM]
 gi|83838490|gb|EAP77786.1| ribosomal protein S20 [Roseovarius nubinhibens ISM]
          Length = 87

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  +R  +NK+RRS +R+++R   EAI  G  + AT A R A+  + +
Sbjct: 1  MANTPQSKKRARQNEKRFAVNKARRSRIRTYLRKVEEAIASGDKDAATSALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRLS R+K +
Sbjct: 61 GVTKGVFHKNTASRKISRLSARVKAL 86


>gi|149202938|ref|ZP_01879909.1| ribosomal protein S20 [Roseovarius sp. TM1035]
 gi|149143484|gb|EDM31520.1| ribosomal protein S20 [Roseovarius sp. TM1035]
          Length = 89

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  +R  INKSRRS +R+F+R   EAI  G  + A  A R A+  + +
Sbjct: 1  MANTPQSKKRARQNEKRFAINKSRRSRIRTFLRKVEEAIASGDKDAAVTALRNAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+ H N ASRK+SRLS R+K I  S
Sbjct: 61 GVTKGVVHKNTASRKISRLSSRVKAIAQS 89


>gi|190571374|ref|YP_001975732.1| ribosomal protein S20 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|213018773|ref|ZP_03334581.1| ribosomal protein S20 [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
 gi|226695440|sp|B3CMH0|RS20_WOLPP RecName: Full=30S ribosomal protein S20
 gi|190357646|emb|CAQ55090.1| ribosomal protein S20 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|212995724|gb|EEB56364.1| ribosomal protein S20 [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
          Length = 89

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 59/89 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKM++ IA+RTL+NK R+S  R+ +R   + I  G  E    A R AES + K
Sbjct: 1  MANHKSAKKMMKVIAKRTLVNKMRKSKTRTAIRRLVDIIKSGDKENVVLAFRNAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+ H N A+RK+SRL+ ++K ++T+
Sbjct: 61 CVNKGVIHRNTAARKISRLNAKVKALMTA 89


>gi|90426414|ref|YP_534784.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris BisB18]
 gi|118573837|sp|Q20WM1|RS20_RHOPB RecName: Full=30S ribosomal protein S20
 gi|90108428|gb|ABD90465.1| SSU ribosomal protein S20P [Rhodopseudomonas palustris BisB18]
          Length = 88

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 55/83 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT++NKSRR+ +R  +R   EAI  G  + A +A  +AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTIVNKSRRTQMRGAVRIVEEAIASGDRDAALKAMIRAEPELMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N ASRKVSRLS ++
Sbjct: 61 AAQRNIVHKNTASRKVSRLSHQI 83


>gi|254419817|ref|ZP_05033541.1| ribosomal protein S20 [Brevundimonas sp. BAL3]
 gi|196185994|gb|EDX80970.1| ribosomal protein S20 [Brevundimonas sp. BAL3]
          Length = 89

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 55/84 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K IRKI  RT +NK+RRS VR+++R   EA+  G    A  A  +A+S + +
Sbjct: 1  MANNPGARKAIRKIEARTEVNKARRSRVRTYLRKFQEALAGGDATAAKTAFVEAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A SKG+ H N  SRKVSRL+ +LK
Sbjct: 61 AVSKGVVHKNTGSRKVSRLAAQLK 84


>gi|75677321|ref|YP_319742.1| 30S ribosomal protein S20 [Nitrobacter winogradskyi Nb-255]
 gi|90111922|sp|Q3SMV1|RS20_NITWN RecName: Full=30S ribosomal protein S20
 gi|74422191|gb|ABA06390.1| SSU ribosomal protein S20P [Nitrobacter winogradskyi Nb-255]
          Length = 88

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 55/83 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT IN+SRR+ +R  +R   EAI  G  + A +A ++AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTAINRSRRTLMRGTVRIVEEAIAKGDRDAAIQAMKRAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N ASRKVSRL+ R+
Sbjct: 61 AGQQNIIHKNNASRKVSRLTHRI 83


>gi|254463433|ref|ZP_05076849.1| ribosomal protein S20 [Rhodobacterales bacterium HTCC2083]
 gi|206680022|gb|EDZ44509.1| ribosomal protein S20 [Rhodobacteraceae bacterium HTCC2083]
          Length = 87

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK+RRS +R+F+R   EAIT G  + A+ A R A+  I +
Sbjct: 1  MANTPQAKKRARQNEARFQVNKARRSRIRTFLRKVEEAITSGDKDAASAALRDAQPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N  +RK+SRLS R+K I
Sbjct: 61 GVTKGVYHKNTVARKMSRLSARVKAI 86


>gi|39937894|ref|NP_950170.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris CGA009]
 gi|192293679|ref|YP_001994284.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris TIE-1]
 gi|59798740|sp|Q6N0C7|RS20_RHOPA RecName: Full=30S ribosomal protein S20; AltName: Full=RRP-S20
 gi|226695410|sp|B3QDE9|RS20_RHOPT RecName: Full=30S ribosomal protein S20
 gi|39651754|emb|CAE30276.1| 30S ribosomal protein S20 [Rhodopseudomonas palustris CGA009]
 gi|192287428|gb|ACF03809.1| ribosomal protein S20 [Rhodopseudomonas palustris TIE-1]
          Length = 88

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 53/80 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NKSRR+ +R  +R   EAI  G  + A +A  +AE  + +
Sbjct: 1  MANTSSAKKATRKIARRTAVNKSRRTQMRGSVRIVEEAIASGDRDAALKAMARAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  + I H NAASRKVSRL+
Sbjct: 61 AAQRNIIHRNAASRKVSRLT 80


>gi|148259020|ref|YP_001243605.1| 30S ribosomal protein S20 [Bradyrhizobium sp. BTAi1]
 gi|166223909|sp|A5EU55|RS20_BRASB RecName: Full=30S ribosomal protein S20
 gi|146411193|gb|ABQ39699.1| SSU ribosomal protein S20P [Bradyrhizobium sp. BTAi1]
          Length = 88

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 54/83 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT+INKSRR+ +R  +R   +AI  G  E A +A   AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTIINKSRRTQMRGAVRSVEDAIKKGDREAALKAMANAEPQLMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N ASRKVSRL+ ++
Sbjct: 61 AAQRNIIHKNNASRKVSRLTHQI 83


>gi|92119436|ref|YP_579165.1| 30S ribosomal protein S20 [Nitrobacter hamburgensis X14]
 gi|118573829|sp|Q1QGE2|RS20_NITHX RecName: Full=30S ribosomal protein S20
 gi|91802330|gb|ABE64705.1| SSU ribosomal protein S20P [Nitrobacter hamburgensis X14]
          Length = 88

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKI RRT +NKSRR+ +R  +R   EAI  G  + A +A ++AE  + +
Sbjct: 1  MANTHSAKKATRKITRRTAVNKSRRTLMRGSVRIVEEAIAKGDRDAAIQAMKRAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N+ASRKVSRL+ R+
Sbjct: 61 AGQQNIVHKNSASRKVSRLTHRI 83


>gi|148284189|ref|YP_001248279.1| 30S ribosomal protein S20 [Orientia tsutsugamushi str. Boryong]
 gi|166223960|sp|A5CCI7|RS20_ORITB RecName: Full=30S ribosomal protein S20
 gi|146739628|emb|CAM79417.1| ribosomal protein S20 [Orientia tsutsugamushi str. Boryong]
          Length = 90

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K IR+  +R LINKSR+S+V++F++    AI  G  + A+EA   A S + K
Sbjct: 1  MANHKSTQKSIRQDQKRNLINKSRKSNVKTFLKRVTLAINAGDKKVASEALSAAHSKLAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGIF  N  SRKVSRLS+++K +
Sbjct: 61 AANKGIFKLNTVSRKVSRLSRKIKQL 86


>gi|146343892|ref|YP_001208940.1| 30S ribosomal protein S20 [Bradyrhizobium sp. ORS278]
 gi|166223910|sp|A4Z3J9|RS20_BRASO RecName: Full=30S ribosomal protein S20
 gi|146196698|emb|CAL80725.1| 30S ribosomal protein S20 [Bradyrhizobium sp. ORS278]
          Length = 89

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 51/79 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT+INKSRR+ +R  +R   +AI  G  E A +A   AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTIINKSRRTQMRGAVRSVEDAIKKGDREAALKAMANAEPQLMR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A  + I H N ASRKVSRL
Sbjct: 61 AAQRNIIHKNNASRKVSRL 79


>gi|299133400|ref|ZP_07026595.1| ribosomal protein S20 [Afipia sp. 1NLS2]
 gi|298593537|gb|EFI53737.1| ribosomal protein S20 [Afipia sp. 1NLS2]
          Length = 88

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 53/83 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT INKSRR+ +R  +R    AI  G    A EA ++AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTAINKSRRTQMRGSVRSVEAAIEKGDRTAALEAMKQAEPQLMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N ASRKVSRL+ ++
Sbjct: 61 AAQRNIIHKNNASRKVSRLTAQI 83


>gi|85713962|ref|ZP_01044951.1| Ribosomal protein S20p [Nitrobacter sp. Nb-311A]
 gi|85699088|gb|EAQ36956.1| Ribosomal protein S20p [Nitrobacter sp. Nb-311A]
          Length = 88

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT IN+SRR+ +R  +R   EAI  G  + A +A ++AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTAINRSRRTLMRGSVRIVEEAIAKGDRDTAIQAMKRAEPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N ASRK+SRL+ R+
Sbjct: 61 AGQQKIIHKNNASRKISRLTHRI 83


>gi|294085127|ref|YP_003551887.1| 30S ribosomal protein S20p [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292664702|gb|ADE39803.1| Ribosomal protein S20p [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 88

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK IR+ A R LIN +R S +R+F++    AI  G    A EA R A+  IQ+
Sbjct: 1  MANHKSAKKRIRRNANRALINGARMSRIRTFVKKVETAIASGDAAVAREALRVAQPEIQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N ASRK+SRL+ R+K +
Sbjct: 61 GVTRGVVHRNTASRKISRLAARVKAL 86


>gi|209883693|ref|YP_002287550.1| ribosomal protein S20 [Oligotropha carboxidovorans OM5]
 gi|226736529|sp|B6JCV5|RS20_OLICO RecName: Full=30S ribosomal protein S20
 gi|209871889|gb|ACI91685.1| ribosomal protein S20 [Oligotropha carboxidovorans OM5]
          Length = 88

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 50/79 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NKSRR+ +R  +R    AI  G    A EA ++AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTAVNKSRRTQMRGSVRLVEAAILKGDRAAAVEAMKQAEPQLMR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A  + I H N ASRKVSRL
Sbjct: 61 AAQRSIIHKNTASRKVSRL 79


>gi|189183977|ref|YP_001937762.1| 30S ribosomal protein S20 [Orientia tsutsugamushi str. Ikeda]
 gi|226695395|sp|B3CT31|RS20_ORITI RecName: Full=30S ribosomal protein S20
 gi|189180748|dbj|BAG40528.1| 30S ribosomal protein S20 [Orientia tsutsugamushi str. Ikeda]
          Length = 90

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 58/86 (67%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K IR+  +R LINKSR+S+V++F++    AI  G  + A+EA   A S + K
Sbjct: 1  MANHKSTQKSIRQDQKRNLINKSRKSNVKTFLKRVTLAINAGDKKVASEALSAAHSKLAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI+  N  SRKVSRLS+++K +
Sbjct: 61 AANKGIYKLNTVSRKVSRLSRKIKQL 86


>gi|163745034|ref|ZP_02152394.1| 30S ribosomal protein S20 [Oceanibulbus indolifex HEL-45]
 gi|161381852|gb|EDQ06261.1| 30S ribosomal protein S20 [Oceanibulbus indolifex HEL-45]
          Length = 87

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   + K  R+  +R  INK+RRS +R+++R   EAI  G  E AT A + A+  + +
Sbjct: 1  MANTTQSAKRARQNEKRFAINKARRSRIRTYIRKVEEAIASGDKEAATNALKTAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRLS R+K +
Sbjct: 61 GVTKGVFHKNTASRKMSRLSARVKAL 86


>gi|255263125|ref|ZP_05342467.1| ribosomal protein S20 [Thalassiobium sp. R2A62]
 gi|255105460|gb|EET48134.1| ribosomal protein S20 [Thalassiobium sp. R2A62]
          Length = 87

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK+RRS +R+++R   EAI  G  + AT A R A+  + +
Sbjct: 1  MANTPQAKKRARQNEARFQVNKARRSRIRTYLRKVEEAIASGDKDAATSALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N  +RK+SRLS R+K I
Sbjct: 61 GVTKGVYHKNTVARKMSRLSSRVKAI 86


>gi|162147554|ref|YP_001602015.1| 30S ribosomal protein S20 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209545660|ref|YP_002277889.1| 30S ribosomal protein S20 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|189044866|sp|A9HI31|RS20_GLUDA RecName: Full=30S ribosomal protein S20
 gi|161786131|emb|CAP55713.1| 30S ribosomal protein S20 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209533337|gb|ACI53274.1| ribosomal protein S20 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 89

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 56/89 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  RR   N +R S +R+F++    AI  G  +EAT A R A+  +Q+
Sbjct: 1  MANTASARKRIRQNERRNARNTARVSRMRTFVKKVEAAIASGNKDEATAALRAAQPEMQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A  KG+ H N  +RK+SRLS R+K I+ +
Sbjct: 61 ASGKGVIHANTVARKISRLSARIKSIVAA 89


>gi|126730154|ref|ZP_01745966.1| ribosomal protein S20 [Sagittula stellata E-37]
 gi|126709534|gb|EBA08588.1| ribosomal protein S20 [Sagittula stellata E-37]
          Length = 88

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  +R  +NK+RRS +R+F+R   EAI  G    A EA + A+  + +
Sbjct: 1  MANTPQSKKRARQSEKRFAVNKARRSRIRTFIRKVEEAIASGDQAAAQEALKVAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVFHKNTASRKMSRLAARVKAV 86


>gi|254488266|ref|ZP_05101471.1| ribosomal protein S20 [Roseobacter sp. GAI101]
 gi|214045135|gb|EEB85773.1| ribosomal protein S20 [Roseobacter sp. GAI101]
          Length = 87

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  INK+RRS +R+F+R   EAI  G  + +  A R A+  + +
Sbjct: 1  MANTPQAKKRARQNEARFQINKARRSRIRTFLRKVEEAIESGDKDASVAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVFHKNTASRKMSRLASRVKAL 86


>gi|310816812|ref|YP_003964776.1| ribosomal protein S20 [Ketogulonicigenium vulgare Y25]
 gi|308755547|gb|ADO43476.1| ribosomal protein S20 [Ketogulonicigenium vulgare Y25]
          Length = 89

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 55/89 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   + K  R+ A R  +NK RRS +R+++R   EA+  G    A EA + A+  + +
Sbjct: 1  MANTPQSAKRARQNAARFAVNKMRRSRIRTYLRKVEEALASGDQAVAAEALKNAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            +KG+FH N ASRKVSRL+ R+K + T+
Sbjct: 61 GVTKGVFHKNTASRKVSRLAARVKALATA 89


>gi|296115227|ref|ZP_06833868.1| 30S ribosomal protein S20 [Gluconacetobacter hansenii ATCC 23769]
 gi|295978328|gb|EFG85065.1| 30S ribosomal protein S20 [Gluconacetobacter hansenii ATCC 23769]
          Length = 89

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  RR   N +R S VR+F++    AI  GK E+A+ A R A+  +Q+
Sbjct: 1  MANTASARKRIRQTERRNARNTARISRVRTFVKKVETAIEAGKKEDASVALRAAQPELQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N  +R++SRLS R+K +
Sbjct: 61 AVGKGVMHANTVARRISRLSARIKAL 86


>gi|167649034|ref|YP_001686697.1| 30S ribosomal protein S20 [Caulobacter sp. K31]
 gi|189044852|sp|B0T7D5|RS20_CAUSK RecName: Full=30S ribosomal protein S20
 gi|167351464|gb|ABZ74199.1| ribosomal protein S20 [Caulobacter sp. K31]
          Length = 91

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IRKIARRT +N +RRS VR+F+R   +A+  G    A  A  +A+S + +
Sbjct: 1  MANNPGAKKAIRKIARRTEVNTARRSRVRTFLRKFEDALAAGDAAVAKAAFIEAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A SKG+ H N  SRKVSRL+ RLK +  +A
Sbjct: 61 AVSKGVVHPNTGSRKVSRLAARLKKLDQAA 90


>gi|85705686|ref|ZP_01036783.1| ribosomal protein S20 [Roseovarius sp. 217]
 gi|85669676|gb|EAQ24540.1| ribosomal protein S20 [Roseovarius sp. 217]
          Length = 87

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  ++  +R  +NKSRRS +R+F+R   EAI  G  + A  A R A+  + +
Sbjct: 1  MANTPQSKKRAKQNEKRFAVNKSRRSRIRTFIRKVEEAIASGDQDAAVTALRNAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N ASRK+SRLS R+K +
Sbjct: 61 GVTKGVVHKNTASRKISRLSARVKSL 86


>gi|148262084|ref|YP_001236211.1| ribosomal protein S20 [Acidiphilium cryptum JF-5]
 gi|326405596|ref|YP_004285678.1| 30S ribosomal protein S20 [Acidiphilium multivorum AIU301]
 gi|166200004|sp|A5G360|RS20_ACICJ RecName: Full=30S ribosomal protein S20
 gi|146403765|gb|ABQ32292.1| SSU ribosomal protein S20P [Acidiphilium cryptum JF-5]
 gi|325052458|dbj|BAJ82796.1| 30S ribosomal protein S20 [Acidiphilium multivorum AIU301]
          Length = 90

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 56/90 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+   RT  NK+RRS V SF+R   EAI  G   EA  A   A+  +Q+
Sbjct: 1  MANIASAQKRIRQTLVRTARNKARRSRVHSFIRKVEEAIATGNHIEARTAFIAAQPELQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+   N ASRK+SRLS R+K +  SA
Sbjct: 61 AVTKGVLKANTASRKLSRLSARVKALSASA 90


>gi|254475381|ref|ZP_05088767.1| ribosomal protein S20 [Ruegeria sp. R11]
 gi|214029624|gb|EEB70459.1| ribosomal protein S20 [Ruegeria sp. R11]
          Length = 87

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  INK+RRS +R+F+R A EAI  G  E A  A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKAEEAIASGDKEAAAAAVRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG++H N ASRK+SRL+ R+K +
Sbjct: 61 GVSKGVYHKNTASRKISRLTARVKAL 86


>gi|258542327|ref|YP_003187760.1| 30S ribosomal protein S20 [Acetobacter pasteurianus IFO 3283-01]
 gi|256633405|dbj|BAH99380.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636464|dbj|BAI02433.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639517|dbj|BAI05479.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642573|dbj|BAI08528.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645628|dbj|BAI11576.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648681|dbj|BAI14622.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651734|dbj|BAI17668.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654725|dbj|BAI20652.1| SSU ribosomal protein S20P [Acetobacter pasteurianus IFO 3283-12]
          Length = 89

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+ A+RT  N +R+S +R+F++    A+  G    A EA R A+  IQ+
Sbjct: 1  MANIASARKRIRQTAKRTARNTARKSRMRTFIKKVETAVEAGDHGAAREALRLAQPEIQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N  +RK+SRLS R+K +
Sbjct: 61 AATKGVIHHNTVARKISRLSARVKAL 86


>gi|209966318|ref|YP_002299233.1| 30S ribosomal protein S20 [Rhodospirillum centenum SW]
 gi|226695409|sp|B6IVU7|RS20_RHOCS RecName: Full=30S ribosomal protein S20
 gi|209959784|gb|ACJ00421.1| ribosomal protein S20 [Rhodospirillum centenum SW]
          Length = 88

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+I +RT IN++R S +R+F++    AI  G    A EA R+A+  + +
Sbjct: 1  MANHKSAEKRIRQIKKRTEINRARISRIRTFVKKVELAIASGDKAAANEAFREAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N  SRK+SRL++R+K +
Sbjct: 61 GATKGVLHRNTVSRKLSRLNQRIKAL 86


>gi|300025050|ref|YP_003757661.1| ribosomal protein S20 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526871|gb|ADJ25340.1| ribosomal protein S20 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 88

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R++ RRT INK+RR+ V+S +R   EAI  G   +A  A   AE V+ +
Sbjct: 1  MANTSSAKKAARQMIRRTDINKARRTRVKSEVRAVEEAIKAGDQGKALAALAAAEPVLAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H   ASRKVSRL++R+KG+
Sbjct: 61 TAQKGLMHKKTASRKVSRLAQRVKGM 86


>gi|260574422|ref|ZP_05842426.1| ribosomal protein S20 [Rhodobacter sp. SW2]
 gi|259023318|gb|EEW26610.1| ribosomal protein S20 [Rhodobacter sp. SW2]
          Length = 91

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+   R  +NK+RRS +R+F+R   EA+  G  + A  A R  +  + +
Sbjct: 1  MANSPQSKKRARQSEARYAVNKARRSRIRTFLRKVEEALASGNQDAAAAALRVVQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +KG+ H N  +RK+SRLS R+KG+ T A
Sbjct: 61 GVTKGVLHKNTVARKMSRLSSRVKGLATVA 90


>gi|88607938|ref|YP_505873.1| 30S ribosomal protein S20 [Anaplasma phagocytophilum HZ]
 gi|115305668|sp|Q2GIC8|RS20_ANAPZ RecName: Full=30S ribosomal protein S20
 gi|88599001|gb|ABD44471.1| ribosomal protein S20 [Anaplasma phagocytophilum HZ]
          Length = 96

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFG-KIEEATEACRKAESVIQ 59
          M N  SAKKM+R I +RTL N+ R+S VR+ ++    A+     IE+A  A RKAES I 
Sbjct: 1  MPNHASAKKMVRVIGKRTLSNRVRKSRVRNSVKAFVAALEANSPIEDAIAAFRKAESNIH 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKG 85
          K  +KG+FH N A+RK+S LS +LK 
Sbjct: 61 KCVNKGVFHRNTAARKISALSGKLKA 86


>gi|307266447|ref|ZP_07547983.1| ribosomal protein S20 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389875|ref|ZP_08211439.1| ribosomal protein S20 [Thermoanaerobacter ethanolicus JW 200]
 gi|306918555|gb|EFN48793.1| ribosomal protein S20 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994143|gb|EGD52571.1| ribosomal protein S20 [Thermoanaerobacter ethanolicus JW 200]
          Length = 94

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  IA+RTL NK  +S V++F++  NE++  G IE   E  R A   + K
Sbjct: 1  MANTKSAKKRISVIAKRTLRNKMIKSRVKTFIKKFNESLATGDIETIKEKLRLAVKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H N  +RK SRL  +   +L SA
Sbjct: 61 AATKGVLHKNTVARKKSRLYAKFNNLLKSA 90


>gi|260431700|ref|ZP_05785671.1| ribosomal protein S20 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415528|gb|EEX08787.1| ribosomal protein S20 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 87

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  INK+RRS +R+F+R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRYAINKARRSRIRTFLRKVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N A+RK+SRLS R+K +
Sbjct: 61 GVTKGVFHKNTAARKMSRLSARVKAL 86


>gi|210623837|ref|ZP_03294086.1| hypothetical protein CLOHIR_02037 [Clostridium hiranonis DSM 13275]
 gi|210153332|gb|EEA84338.1| hypothetical protein CLOHIR_02037 [Clostridium hiranonis DSM 13275]
          Length = 102

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SAKK I  I ++T +N+ R+S V++ +R  +EA+  G +EEA    + A+  I +
Sbjct: 15  MANIKSAKKRISVIEKKTALNRVRKSQVKTAIRRFDEAVAAGNVEEAKARFQYAQKRIYQ 74

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
             SKG  H NAASRKV++L+++L G+
Sbjct: 75  VASKGTIHKNAASRKVAKLAQKLNGM 100


>gi|114326824|ref|YP_743981.1| 30S ribosomal protein S20 [Granulibacter bethesdensis CGDNIH1]
 gi|122328191|sp|Q0BVU4|RS20_GRABC RecName: Full=30S ribosomal protein S20
 gi|114314998|gb|ABI61058.1| SSU ribosomal protein S20P [Granulibacter bethesdensis CGDNIH1]
          Length = 89

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 57/89 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+I  RT  N +R+S +R+F++    AI  G    A EA R+A+  +Q+
Sbjct: 1  MANTASARKRIRQIKVRTERNAARKSRMRTFVKKVETAIASGNHTAANEALREAQPEMQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A  KG+ H N  +R++SRL+ R+K + T+
Sbjct: 61 AAGKGVIHRNTVARRLSRLTARIKALATA 89


>gi|254466007|ref|ZP_05079418.1| ribosomal protein S20 [Rhodobacterales bacterium Y4I]
 gi|206686915|gb|EDZ47397.1| ribosomal protein S20 [Rhodobacterales bacterium Y4I]
          Length = 87

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  +NK+RRS +R+F+R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAVNKARRSRIRTFLRKVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N ASRK+SRLS R+K +
Sbjct: 61 GVTKGVYHKNTASRKISRLSARVKAL 86


>gi|27375943|ref|NP_767472.1| 30S ribosomal protein S20 [Bradyrhizobium japonicum USDA 110]
 gi|59798895|sp|Q89W61|RS20_BRAJA RecName: Full=30S ribosomal protein S20
 gi|27349081|dbj|BAC46097.1| 30S ribosomal protein S20 [Bradyrhizobium japonicum USDA 110]
          Length = 88

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  RKIARRT +NKSRR+ +R  +R+  EAI  G    A +A   AE  + +
Sbjct: 1  MANTTSAKKATRKIARRTAVNKSRRTQMRGAVRNVEEAIKTGDRAAAVKALANAEPALMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  + I H N ASRKVSRL+ ++
Sbjct: 61 AAQRNIIHKNNASRKVSRLTAQI 83


>gi|126738628|ref|ZP_01754333.1| ribosomal protein S20 [Roseobacter sp. SK209-2-6]
 gi|126720427|gb|EBA17133.1| ribosomal protein S20 [Roseobacter sp. SK209-2-6]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  +NK+RRS +R+++R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAVNKARRSRIRTYLRKVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N ASRKVSRL+ R+K I
Sbjct: 61 GVTKGVYHKNTASRKVSRLAARVKAI 86


>gi|259418123|ref|ZP_05742042.1| ribosomal protein S20 [Silicibacter sp. TrichCH4B]
 gi|259347029|gb|EEW58843.1| ribosomal protein S20 [Silicibacter sp. TrichCH4B]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  INK+RRS +R+++R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANTPQAKKRARQNEKRFAINKARRSRIRTYLRKVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N ASRK+SRLS R+K +
Sbjct: 61 GVTKGVYHKNTASRKISRLSARVKAL 86


>gi|86139418|ref|ZP_01057987.1| ribosomal protein S20 [Roseobacter sp. MED193]
 gi|85823921|gb|EAQ44127.1| ribosomal protein S20 [Roseobacter sp. MED193]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  +NK+RRS +R+F+R   EAI  G  E+A  A R A   + +
Sbjct: 1  MANSPQAKKRARQNEKRFAVNKARRSRIRTFLRKVEEAIESGNKEDAAAALRLAAPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N ASRKVSRL+ R+K +
Sbjct: 61 GVTKGVYHKNTASRKVSRLTARVKAL 86


>gi|157826037|ref|YP_001493757.1| 30S ribosomal protein S20 [Rickettsia akari str. Hartford]
 gi|166223977|sp|A8GPC4|RS20_RICAH RecName: Full=30S ribosomal protein S20
 gi|157799995|gb|ABV75249.1| 30S ribosomal protein S20 [Rickettsia akari str. Hartford]
          Length = 90

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK+R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKRTLINKARSSAIKTFIKKVVHEISLGNKENANLALSVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLSK++K +
Sbjct: 61 GVKKNIIKLNTASRKISRLSKQIKSL 86


>gi|330994262|ref|ZP_08318190.1| 30S ribosomal protein S20 [Gluconacetobacter sp. SXCC-1]
 gi|329758729|gb|EGG75245.1| 30S ribosomal protein S20 [Gluconacetobacter sp. SXCC-1]
          Length = 111

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (62%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SA+K IR+   R   N +R S VR+F++    AI  GK +EA  A R+A+  +Q+
Sbjct: 23  MANTASARKRIRQNEVRNARNTARMSRVRTFVKKVETAILAGKKDEAAVALREAQPELQR 82

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A  KG+ H N  +R++SRLS R+K +
Sbjct: 83  AVGKGVMHANTVARRISRLSARIKSL 108


>gi|289578093|ref|YP_003476720.1| ribosomal protein S20 [Thermoanaerobacter italicus Ab9]
 gi|297544366|ref|YP_003676668.1| 30S ribosomal protein S20 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
 gi|289527806|gb|ADD02158.1| ribosomal protein S20 [Thermoanaerobacter italicus Ab9]
 gi|296842141|gb|ADH60657.1| ribosomal protein S20 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
          Length = 93

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  IA+RTL NK  +S V++F+ + N+++  G IE   E  R A   + K
Sbjct: 1  MANTKSAKKRISVIAKRTLRNKMIKSRVKTFISNFNKSLATGDIETIKEKLRLAVKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H N A+RK SRL  +   +L SA
Sbjct: 61 AVTKGVLHKNTAARKKSRLYAKFNALLKSA 90


>gi|67458696|ref|YP_246320.1| 30S ribosomal protein S20 [Rickettsia felis URRWXCal2]
 gi|75536842|sp|Q4UMQ3|RS20_RICFE RecName: Full=30S ribosomal protein S20
 gi|67004229|gb|AAY61155.1| 30S ribosomal protein S20 [Rickettsia felis URRWXCal2]
          Length = 90

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVAHEISLGNKENANLALSVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLSK++K +
Sbjct: 61 GVKKNIIKLNTASRKISRLSKQIKSL 86


>gi|15604479|ref|NP_220997.1| 30S ribosomal protein S20 [Rickettsia prowazekii str. Madrid E]
 gi|6226093|sp|Q9ZCT1|RS20_RICPR RecName: Full=30S ribosomal protein S20
 gi|3861173|emb|CAA15073.1| 30S RIBOSOMAL PROTEIN S20 (rpsT) [Rickettsia prowazekii]
 gi|292572261|gb|ADE30176.1| 30S ribosomal protein S20 [Rickettsia prowazekii Rp22]
          Length = 90

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 56/89 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK++R+  +RTLINK R S++++F++     I+ G  E+A  A   A+S I +
Sbjct: 1  MANHSSAKKVVRQTVKRTLINKKRSSAIKTFIKKVIHEISRGNKEDANLALSIAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
             K I   N ASRK+ RLSK++K +  S
Sbjct: 61 GVKKNIIKLNTASRKIRRLSKQIKNLYKS 89


>gi|51473813|ref|YP_067570.1| 30S ribosomal protein S20 [Rickettsia typhi str. Wilmington]
 gi|59798671|sp|Q68WA4|RS20_RICTY RecName: Full=30S ribosomal protein S20
 gi|51460125|gb|AAU04088.1| 30S ribosomal protein S20 [Rickettsia typhi str. Wilmington]
          Length = 90

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK++R+  +RTLINK R S++++F++     I+ G  E+A  A   A+S I +
Sbjct: 1  MANHSSAKKVVRQTIKRTLINKKRSSAIKTFIKKVMYEISRGNKEDANLALSVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 61 GVKKNIIKLNTASRKISRLSRQIKNL 86


>gi|56695073|ref|YP_165420.1| 30S ribosomal protein S20 [Ruegeria pomeroyi DSS-3]
 gi|62510981|sp|Q5LWV5|RS20_SILPO RecName: Full=30S ribosomal protein S20
 gi|56676810|gb|AAV93476.1| ribosomal protein S20 [Ruegeria pomeroyi DSS-3]
          Length = 87

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A K  R+  +R  INK+RRS +R+F+R   EAI  G  + AT A R A+  + +
Sbjct: 1  MANSPQAAKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKDAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+FH N ASRK+SRLS R+K +
Sbjct: 61 GVSKGVFHKNTASRKMSRLSSRVKAL 86


>gi|83855141|ref|ZP_00948671.1| ribosomal protein S20 [Sulfitobacter sp. NAS-14.1]
 gi|83941664|ref|ZP_00954126.1| ribosomal protein S20 [Sulfitobacter sp. EE-36]
 gi|83842984|gb|EAP82151.1| ribosomal protein S20 [Sulfitobacter sp. NAS-14.1]
 gi|83847484|gb|EAP85359.1| ribosomal protein S20 [Sulfitobacter sp. EE-36]
          Length = 87

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  INK+RRS +R+F+R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANTPQAKKRARQNEARFQINKARRSRIRTFLRKVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVFHKNTASRKMSRLASRVKAL 86


>gi|164686308|ref|ZP_02210338.1| hypothetical protein CLOBAR_02746 [Clostridium bartlettii DSM
          16795]
 gi|164601910|gb|EDQ95375.1| hypothetical protein CLOBAR_02746 [Clostridium bartlettii DSM
          16795]
          Length = 88

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 57/86 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I ++T +N+ R+S V++ +R   EA+  G +EEAT+  + A+  I +
Sbjct: 1  MANIKSAKKRIKVIDKKTALNRVRKSQVKTAIRRFEEAVNAGNVEEATQRFQFAQKKISQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG  H NAA+RKV++L+ +L  +
Sbjct: 61 VASKGTIHKNAAARKVAKLAHKLNSM 86


>gi|163738133|ref|ZP_02145549.1| 30S ribosomal protein S20 [Phaeobacter gallaeciensis BS107]
 gi|163743749|ref|ZP_02151123.1| ribosomal protein S20 [Phaeobacter gallaeciensis 2.10]
 gi|161383010|gb|EDQ07405.1| ribosomal protein S20 [Phaeobacter gallaeciensis 2.10]
 gi|161388749|gb|EDQ13102.1| 30S ribosomal protein S20 [Phaeobacter gallaeciensis BS107]
          Length = 87

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 57/86 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  +NK+RRS +R+F+R A EAI  G  E A EA R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAVNKARRSRIRTFLRKAEEAIASGDKEAAAEAVRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVYHKNTASRKISRLTARVKAL 86


>gi|99082871|ref|YP_615025.1| 30S ribosomal protein S20 [Ruegeria sp. TM1040]
 gi|118573843|sp|Q1GC53|RS20_SILST RecName: Full=30S ribosomal protein S20
 gi|99039151|gb|ABF65763.1| SSU ribosomal protein S20P [Ruegeria sp. TM1040]
          Length = 87

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  INK+RRS +R+F+R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G++H N ASRK+SRL+ R+K +
Sbjct: 61 GVTRGVYHKNTASRKISRLAARVKAL 86


>gi|251772852|gb|EES53411.1| Ribosomal protein S20 [Leptospirillum ferrodiazotrophum]
          Length = 90

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 56/89 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN +S KK IR+ A+R   N+   +++R+  R   EAIT GK +EA EA  +    I  
Sbjct: 1  MANHESTKKDIRRNAKRRDRNRQAITTMRTLARKVEEAITAGKTDEAKEALMRVVPFIDH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A ++GI H N ASRK+SRL+ ++ G +++
Sbjct: 61 AVNRGILHRNTASRKISRLTLKVNGAVSA 89


>gi|291279913|ref|YP_003496748.1| 30S ribosomal protein S20 [Deferribacter desulfuricans SSM1]
 gi|290754615|dbj|BAI80992.1| 30S ribosomal protein S20 [Deferribacter desulfuricans SSM1]
          Length = 91

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 58/90 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK IR+  +R L NKS +S +++F +    A+  G IEEA +   +A  VI K
Sbjct: 1  MAHSLSAKKRIRQNEKRRLRNKSYKSMMKTFTKKFLAAVEEGNIEEAEKRFNEAVKVIYK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKGI H N A+R+V+RL+KRL+ +  SA
Sbjct: 61 VHSKGIIHKNQAARRVARLAKRLQALKNSA 90


>gi|114762143|ref|ZP_01441611.1| ribosomal protein S20 [Pelagibaca bermudensis HTCC2601]
 gi|114545167|gb|EAU48170.1| ribosomal protein S20 [Roseovarius sp. HTCC2601]
          Length = 87

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  INK+RRS +R+++R   EAI  G  + A  A   A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAINKARRSRIRTYLRKVEEAIASGDQDAAKAALLAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVFHKNTASRKMSRLASRVKAL 86


>gi|225027580|ref|ZP_03716772.1| hypothetical protein EUBHAL_01837 [Eubacterium hallii DSM 3353]
 gi|224955096|gb|EEG36305.1| hypothetical protein EUBHAL_01837 [Eubacterium hallii DSM 3353]
          Length = 90

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I  I  +TL NKS +S V++ +++   A+  G  E A  A   A S I K
Sbjct: 4  LANIKSAKKRILVIETKTLRNKSIKSKVKTCIKNVEVAVAKGDKEAAQAALTVAISEISK 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGIFH N A+RKVSRL+K + GI
Sbjct: 64 ATSKGIFHKNTAARKVSRLTKAVNGI 89


>gi|291166066|gb|EFE28112.1| 30S ribosomal protein S20 [Filifactor alocis ATCC 35896]
          Length = 90

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 54/83 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SA+K I   A++T +NK R+S V++ +R  +EAI  G +E+A E  R A+  I +
Sbjct: 4  LANIKSAQKRISVTAKKTAVNKMRKSQVKTAIRRFDEAILAGDLEKANETFRYAQKKIYQ 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG  H  AA RKVS+L+KRL
Sbjct: 64 IAAKGTIHKKAADRKVSKLAKRL 86


>gi|294679050|ref|YP_003579665.1| 30S ribosomal protein S20 [Rhodobacter capsulatus SB 1003]
 gi|294477870|gb|ADE87258.1| 30S ribosomal protein S20 [Rhodobacter capsulatus SB 1003]
          Length = 88

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  RR  INK+RRS +R+F+R   EAI  G    A  A   A+  + +
Sbjct: 1  MANTPQSKKRARQNERRNDINKARRSRIRTFLRKVEEAIASGDAGVAKAALEAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N  +RK+SRLS R+K +
Sbjct: 61 GITKGVLHKNTVARKMSRLSSRVKAL 86


>gi|84684522|ref|ZP_01012423.1| ribosomal protein S20 [Maritimibacter alkaliphilus HTCC2654]
 gi|84667501|gb|EAQ13970.1| ribosomal protein S20 [Rhodobacterales bacterium HTCC2654]
          Length = 87

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  RR  +NK+RRS +R+++R   EAI  G  E AT A + A+  + +
Sbjct: 1  MANTPQSKKRARQNERRFAVNKARRSRIRTYLRKVEEAIASGDKEAATAALKAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG++H N A+RK+SRLS R+K +
Sbjct: 61 GVTKGVYHKNTAARKMSRLSSRVKAL 86


>gi|260429315|ref|ZP_05783292.1| ribosomal protein S20 [Citreicella sp. SE45]
 gi|260419938|gb|EEX13191.1| ribosomal protein S20 [Citreicella sp. SE45]
          Length = 87

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK+RRS +R+F+R   EAI  G  + A  A R A+  + +
Sbjct: 1  MANSPQAKKRARQNENRFAVNKARRSRIRTFLRKVEEAIASGDKDAAVAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVFHKNTASRKISRLASRVKSL 86


>gi|167037813|ref|YP_001665391.1| 30S ribosomal protein S20 [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|167040713|ref|YP_001663698.1| 30S ribosomal protein S20 [Thermoanaerobacter sp. X514]
 gi|256752145|ref|ZP_05493011.1| ribosomal protein S20 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914753|ref|ZP_07132069.1| ribosomal protein S20 [Thermoanaerobacter sp. X561]
 gi|307724013|ref|YP_003903764.1| 30S ribosomal protein S20 [Thermoanaerobacter sp. X513]
 gi|320116231|ref|YP_004186390.1| 30S ribosomal protein S20 [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
 gi|166854953|gb|ABY93362.1| ribosomal protein S20 [Thermoanaerobacter sp. X514]
 gi|166856647|gb|ABY95055.1| ribosomal protein S20 [Thermoanaerobacter pseudethanolicus ATCC
          33223]
 gi|256748959|gb|EEU61997.1| ribosomal protein S20 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889688|gb|EFK84834.1| ribosomal protein S20 [Thermoanaerobacter sp. X561]
 gi|307581074|gb|ADN54473.1| ribosomal protein S20 [Thermoanaerobacter sp. X513]
 gi|319929322|gb|ADV80007.1| ribosomal protein S20 [Thermoanaerobacter brockii subsp. finnii
          Ako-1]
          Length = 94

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  IA+RTL NK  +S V++F+ + N+++  G IE   E  R A   + K
Sbjct: 1  MANTKSAKKRISIIAKRTLRNKMIKSRVKTFISNFNKSLATGDIETIKEKLRLAVKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H N  +RK SRL  +   +L SA
Sbjct: 61 AATKGVLHKNTVARKKSRLYAKFNALLKSA 90


>gi|157964780|ref|YP_001499604.1| 30S ribosomal protein S20 [Rickettsia massiliae MTU5]
 gi|157844556|gb|ABV85057.1| 30S ribosomal protein S20 [Rickettsia massiliae MTU5]
          Length = 95

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 6  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVHEISLGNKENANLALSVAQSKIMQ 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 66 GVKKNIIKLNTASRKISRLSRQIKSL 91


>gi|89069836|ref|ZP_01157171.1| ribosomal protein S20 [Oceanicola granulosus HTCC2516]
 gi|89044637|gb|EAR50753.1| ribosomal protein S20 [Oceanicola granulosus HTCC2516]
          Length = 87

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  RR  +NK+RRS +R+++R   EA+  G  + A  A R A+  + +
Sbjct: 1  MANSPQSKKRARQAERRLAVNKARRSRIRTYLRKVEEALASGDKDAAANALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRL+ R+K +
Sbjct: 61 GVTKGVFHKNTASRKISRLASRVKKL 86


>gi|165933561|ref|YP_001650350.1| 30S ribosomal protein S20 [Rickettsia rickettsii str. Iowa]
 gi|165908648|gb|ABY72944.1| SSU ribosomal protein S20P [Rickettsia rickettsii str. Iowa]
          Length = 93

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 2  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVHEISLGNKENANIALSVAQSKIMQ 61

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 62 GVKKNIIKLNTASRKISRLSRQIKSL 87


>gi|34581395|ref|ZP_00142875.1| 30S ribosomal protein S20 [Rickettsia sibirica 246]
 gi|157828834|ref|YP_001495076.1| 30S ribosomal protein S20 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|229586983|ref|YP_002845484.1| 30S ribosomal protein S20 [Rickettsia africae ESF-5]
 gi|238650946|ref|YP_002916802.1| 30S ribosomal protein S20 [Rickettsia peacockii str. Rustic]
 gi|166223980|sp|A8GT43|RS20_RICRS RecName: Full=30S ribosomal protein S20
 gi|259494873|sp|C3PP81|RS20_RICAE RecName: Full=30S ribosomal protein S20
 gi|259494874|sp|C4K2F3|RS20_RICPU RecName: Full=30S ribosomal protein S20
 gi|28262780|gb|EAA26284.1| 30S ribosomal protein S20 [Rickettsia sibirica 246]
 gi|157801315|gb|ABV76568.1| 30S ribosomal protein S20 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|228022033|gb|ACP53741.1| 30S ribosomal protein S20 [Rickettsia africae ESF-5]
 gi|238625044|gb|ACR47750.1| 30S ribosomal protein S20 [Rickettsia peacockii str. Rustic]
          Length = 92

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVHEISLGNKENANIALSVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 61 GVKKNIIKLNTASRKISRLSRQIKSL 86


>gi|313673668|ref|YP_004051779.1| SSU ribosomal protein s20p [Calditerrivibrio nitroreducens DSM
          19672]
 gi|312940424|gb|ADR19616.1| SSU ribosomal protein S20P [Calditerrivibrio nitroreducens DSM
          19672]
          Length = 89

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 57/83 (68%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK IR+  +R L N+S +S ++++++   E +  G +E+A    ++A+SVI K
Sbjct: 1  MAHTASAKKRIRQTEKRNLRNRSYKSRMKTYIKKFLEVLKSGDLEKAESVFKEAQSVIAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            SKG+ H N A+R+VSRLS++L
Sbjct: 61 TASKGVIHKNNAARRVSRLSEKL 83


>gi|94264461|ref|ZP_01288249.1| Ribosomal protein S20p [delta proteobacterium MLMS-1]
 gi|93455092|gb|EAT05316.1| Ribosomal protein S20p [delta proteobacterium MLMS-1]
          Length = 90

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+   R   N+S RS +++ +R  NEA+     E+A EA + A  VI K
Sbjct: 1  MANHKSAIKRNRQNQVRRERNQSNRSRIKTLVRRVNEAVNTAASEQANEALQAAVPVIAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+RK+SRLS+R+  +
Sbjct: 61 AVNKGILHRNTAARKISRLSRRVNAL 86


>gi|288959511|ref|YP_003449852.1| small subunit ribosomal protein S20 [Azospirillum sp. B510]
 gi|288911819|dbj|BAI73308.1| small subunit ribosomal protein S20 [Azospirillum sp. B510]
          Length = 86

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  RRT +N++R S +RSF++    AI  G    A EA + A+  + +
Sbjct: 1  MANHKSAEKRIRQTERRTEVNRARISRIRSFVKKVEGAIESGDKSAAAEAFKSAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N  SRK+SRLS  +K +
Sbjct: 61 GVTKGVLHKNTVSRKLSRLSAAIKAL 86


>gi|239948293|ref|ZP_04700046.1| ribosomal protein S20 [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|239922569|gb|EER22593.1| ribosomal protein S20 [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 89

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVHEISLGNKENANLALAVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 61 GVKKNIIKLNTASRKISRLSRQIKSL 86


>gi|254509837|ref|ZP_05121904.1| ribosomal protein S20 [Rhodobacteraceae bacterium KLH11]
 gi|221533548|gb|EEE36536.1| ribosomal protein S20 [Rhodobacteraceae bacterium KLH11]
          Length = 87

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R  +NK+RRS +R+++R   EAI  G  + AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEKRFAVNKARRSRIRTYLRKVEEAIATGDKDAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N A+RK+SRLS R+K +
Sbjct: 61 GVTKGVFHKNTAARKMSRLSARVKAL 86


>gi|149912813|ref|ZP_01901347.1| ribosomal protein S20 [Roseobacter sp. AzwK-3b]
 gi|149813219|gb|EDM73045.1| ribosomal protein S20 [Roseobacter sp. AzwK-3b]
          Length = 87

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+   R  +NK RRS +R+F+R   EAI  G  E A  A R A+  + +
Sbjct: 1  MANTPQSKKRARQSETRLTVNKGRRSRIRTFLRKVEEAIASGDKEAAQAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N ASRK+SRLS R+K +
Sbjct: 61 GVTKGVFHKNTASRKMSRLSARVKSL 86


>gi|20140109|sp|Q92GZ2|RS20_RICCN RecName: Full=30S ribosomal protein S20
          Length = 92

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVHEISIGNKENANIALSVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 61 GVKKNIIKLNTASRKISRLSRQIKSL 86


>gi|15892903|ref|NP_360617.1| 30S ribosomal protein S20 [Rickettsia conorii str. Malish 7]
 gi|15620094|gb|AAL03518.1| 30S ribosomal protein S20 [Rickettsia conorii str. Malish 7]
          Length = 93

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 2  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVHEISIGNKENANIALSVAQSKIMQ 61

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS+++K +
Sbjct: 62 GVKKNIIKLNTASRKISRLSRQIKSL 87


>gi|306821653|ref|ZP_07455251.1| 30S ribosomal protein S20 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|304550398|gb|EFM38391.1| 30S ribosomal protein S20 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
          Length = 94

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++TLINK R S V++ ++    A+  G ++ ATE  R A+  + +
Sbjct: 6  MANIKSAKKRISVIQKKTLINKMRLSQVKTAIKRFELALGAGDMQVATEKLRYAQKKLTQ 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG  H NAASRK+SRL+K+ 
Sbjct: 66 VAAKGTIHKNAASRKISRLTKKF 88


>gi|84501261|ref|ZP_00999466.1| ribosomal protein S20 [Oceanicola batsensis HTCC2597]
 gi|84390552|gb|EAQ03040.1| ribosomal protein S20 [Oceanicola batsensis HTCC2597]
          Length = 87

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R++  RT +NK+RRS +R+F+R   EAI  G    A+ A + A+  + +
Sbjct: 1  MANTPQSKKRARQMLNRTTVNKARRSRIRTFLRKVEEAIASGDKSAASAALQAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+RK+SRLS R+K I
Sbjct: 61 GVTKGVLHKNTAARKMSRLSARVKAI 86


>gi|68171587|ref|ZP_00544960.1| Ribosomal protein S20p [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658183|ref|YP_506901.1| 30S ribosomal protein S20 [Ehrlichia chaffeensis str. Arkansas]
 gi|115305683|sp|Q2GI32|RS20_EHRCR RecName: Full=30S ribosomal protein S20
 gi|67998997|gb|EAM85675.1| Ribosomal protein S20p [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599640|gb|ABD45109.1| ribosomal protein S20 [Ehrlichia chaffeensis str. Arkansas]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKMI+ I +RT++N+ R+S   ++++    A+  G  E   E  +KAES + K
Sbjct: 1  MANHPSAKKMIKVIKKRTMVNRMRKSRAHNYVKKFMAALAAGNKELMIETFKKAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +K I H N A+RK+SR++ +LK  
Sbjct: 61 CVNKKIIHRNTAARKISRMALKLKAF 86


>gi|315499381|ref|YP_004088185.1| ribosomal protein s20 [Asticcacaulis excentricus CB 48]
 gi|315417393|gb|ADU14034.1| ribosomal protein S20 [Asticcacaulis excentricus CB 48]
          Length = 88

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (66%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IRKIARRT +NK+RRS VR+++R   EA+  G    A  A  +A+S + +
Sbjct: 1  MANNPGAKKAIRKIARRTEVNKARRSRVRTYVRKFEEALAAGDAAVAKTAFIEAQSELMR 60

Query: 61 AKSKGIFHGNAASRKVSR 78
          A SKG+ H N  +RKVSR
Sbjct: 61 AVSKGVVHKNTGARKVSR 78


>gi|110677615|ref|YP_680622.1| 30S ribosomal protein S20 [Roseobacter denitrificans OCh 114]
 gi|118573840|sp|Q16DK7|RS20_ROSDO RecName: Full=30S ribosomal protein S20
 gi|109453731|gb|ABG29936.1| ribosomal protein S20 [Roseobacter denitrificans OCh 114]
          Length = 87

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 54/84 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  INK+RRS +R+F+R   EAI  G  E AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEARFQINKARRSRIRTFLRRVEEAIASGDKEAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +KG+FH N A+RK+SRL+ R+K
Sbjct: 61 GVTKGVFHKNTAARKMSRLAARVK 84


>gi|310659108|ref|YP_003936829.1| 30S ribosomal protein S20 [Clostridium sticklandii DSM 519]
 gi|308825886|emb|CBH21924.1| 30S ribosomal subunit protein S20 [Clostridium sticklandii]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I   A++TLIN+ R+S +++ ++    A+  G +E ATE  + A+  I +
Sbjct: 1  MANIKSAKKRISVTAKKTLINRMRKSQIKTAIKRFEAALAEGNMEAATENFKYAQKKIHQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG  H NAA+RKVS+L+ RL
Sbjct: 61 IAAKGTLHKNAAARKVSKLASRL 83


>gi|157804009|ref|YP_001492558.1| 30S ribosomal protein S20 [Rickettsia canadensis str. McKiel]
 gi|166223979|sp|A8EZJ0|RS20_RICCK RecName: Full=30S ribosomal protein S20
 gi|157785272|gb|ABV73773.1| 30S ribosomal protein S20 [Rickettsia canadensis str. McKiel]
          Length = 90

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +RTLINK R S++++F++     I+ G  E A  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKRTLINKKRSSAIKTFIKKVVNEISLGNKENANLALSVAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I   N ASRK+SRLS++++ +
Sbjct: 61 GVKKNIIKLNTASRKISRLSRQIQSM 86


>gi|57238778|ref|YP_179914.1| 30S ribosomal protein S20 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58578702|ref|YP_196914.1| 30S ribosomal protein S20 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58616764|ref|YP_195963.1| 30S ribosomal protein S20 [Ehrlichia ruminantium str. Gardel]
 gi|75432640|sp|Q5FF55|RS20_EHRRG RecName: Full=30S ribosomal protein S20
 gi|81557366|sp|Q5HCC9|RS20_EHRRW RecName: Full=30S ribosomal protein S20
 gi|57160857|emb|CAH57757.1| 30S ribosomal protein S20 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58416376|emb|CAI27489.1| 30S ribosomal protein S20 [Ehrlichia ruminantium str. Gardel]
 gi|58417328|emb|CAI26532.1| 30S ribosomal protein S20 [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 95

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 54/84 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKMI+ I +RT+IN+ R+S   ++++    A+  G  E   E  +KAES + +
Sbjct: 1  MANHPSAKKMIKVIKKRTMINRMRKSRAHNYIKKFMAALAAGNKELMLENFKKAESNLHR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +K I H N A+RK+SRL+ +LK
Sbjct: 61 CVNKKIIHRNTAARKISRLALKLK 84


>gi|161760534|ref|NP_622595.2| 30S ribosomal protein S20 [Thermoanaerobacter tengcongensis MB4]
          Length = 93

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I +RTL NK  +S V++F+R  NE++    IE   E  R A   + K
Sbjct: 1  MANTKSAKKRIAIIKKRTLRNKMIKSRVKTFIRRFNESLATKDIEAIKERLRLAVKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A SKG+ H N A+RK S+L  +   +L SA
Sbjct: 61 AVSKGVLHKNTAARKKSKLYAKFNALLKSA 90


>gi|73666674|ref|YP_302690.1| 30S ribosomal protein S20 [Ehrlichia canis str. Jake]
 gi|108884800|sp|Q3YT63|RS20_EHRCJ RecName: Full=30S ribosomal protein S20
 gi|72393815|gb|AAZ68092.1| SSU ribosomal protein S20P [Ehrlichia canis str. Jake]
          Length = 95

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKKMI+ I +RT++N+ R+S   ++++    A+  G  E   E  +KAES + K
Sbjct: 1  MANHPSAKKMIKVIKKRTMVNRMRKSRAHNYVKKFLLALAAGNKELMVETFKKAESNLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +K I H N A+RK+SR++ +LK
Sbjct: 61 CVNKKIIHRNTAARKISRMALKLK 84


>gi|282883143|ref|ZP_06291742.1| ribosomal protein S20 [Peptoniphilus lacrimalis 315-B]
 gi|281296955|gb|EFA89452.1| ribosomal protein S20 [Peptoniphilus lacrimalis 315-B]
          Length = 89

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 52/83 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I+   R  L NK R + V++ ++  N+A+  GK++EA E  +  +  ++ 
Sbjct: 1  MANIKSAIKRIQVAKRNELQNKYRSTQVKTVIKKFNQALDLGKLDEAKELLKDVDKKLKT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +K + H N ASRK+SRL+K+L
Sbjct: 61 AATKNVIHKNQASRKISRLTKKL 83


>gi|160947402|ref|ZP_02094569.1| hypothetical protein PEPMIC_01336 [Parvimonas micra ATCC 33270]
 gi|158446536|gb|EDP23531.1| hypothetical protein PEPMIC_01336 [Parvimonas micra ATCC 33270]
          Length = 93

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I    ++TL NKSR+S ++++++  + A+    +E A E  R  +  +++
Sbjct: 4  MANIKSALKRIDITKKQTLKNKSRKSEIKTYIKKFDLALAEKNLETANELLRTIDKRLKQ 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A    +FH NAASRKVS+LSKRL    T A
Sbjct: 64 ATEHSVFHKNAASRKVSKLSKRLHDASTQA 93


>gi|93006491|ref|YP_580928.1| 30S ribosomal protein S20 [Psychrobacter cryohalolentis K5]
 gi|118573831|sp|Q1QA59|RS20_PSYCK RecName: Full=30S ribosomal protein S20
 gi|92394169|gb|ABE75444.1| SSU ribosomal protein S20P [Psychrobacter cryohalolentis K5]
          Length = 88

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   + S+RS VR++++  + AI     + ATEA +KA  V+ +
Sbjct: 1  MANTAQARKRARQNTKRRQNSASQRSMVRTYLKRVDAAIAAKDYDAATEAYKKAVPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
             KGI H N A+R+ SRL+K +KG+L
Sbjct: 61 MADKGILHKNKAARRKSRLNKTIKGLL 87


>gi|296533906|ref|ZP_06896432.1| 30S ribosomal protein S20 [Roseomonas cervicalis ATCC 49957]
 gi|296265760|gb|EFH11859.1| 30S ribosomal protein S20 [Roseomonas cervicalis ATCC 49957]
          Length = 92

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+ A R   N++RRS V +F+    +AI+ G    A  A + A+   Q+
Sbjct: 1  MANTASARKRIRQTAVRNERNRARRSRVGTFLTKVEKAISSGDKSAAQAAFKDAQPEFQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N  +RK+SRLS R+K +
Sbjct: 61 AVTKGVLHLNTVARKLSRLSARIKAL 86


>gi|300814986|ref|ZP_07095213.1| ribosomal protein S20 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
 gi|300510907|gb|EFK38180.1| ribosomal protein S20 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 53/88 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I+   R  L NK R + V++ ++  N+A+  GK++EA E  +  +  ++ 
Sbjct: 1  MANIKSAIKRIQVAKRNELQNKYRNTQVKTAIKKFNQALDLGKLDEAKELLKDVDKKLKT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILT 88
          A +K + H N ASRK+SRL+K+L   L 
Sbjct: 61 AATKNVIHKNQASRKISRLTKKLNNKLV 88


>gi|257455864|ref|ZP_05621083.1| ribosomal protein S20 [Enhydrobacter aerosaccus SK60]
 gi|257446712|gb|EEV21736.1| ribosomal protein S20 [Enhydrobacter aerosaccus SK60]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R  +  S+RS VR+F++H  +A+     E ATEA +KA  VI +
Sbjct: 1  MANSAQARKRARQNVKRRQLKASQRSMVRTFIKHVVKAVEDKNYEAATEAYKKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
             KG+ H N A+R  SRL+K +K + T+
Sbjct: 61 IADKGVIHKNKAARHKSRLNKAIKALKTA 89


>gi|83595131|ref|YP_428883.1| 30S ribosomal protein S20P [Rhodospirillum rubrum ATCC 11170]
 gi|118574557|sp|Q2RMP9|RS20_RHORT RecName: Full=30S ribosomal protein S20
 gi|83578045|gb|ABC24596.1| SSU ribosomal protein S20P [Rhodospirillum rubrum ATCC 11170]
          Length = 88

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I + A R+ IN +R   +R+F++    AI  G  + A  A + A   +Q+
Sbjct: 1  MANHKSAKKRILRNASRSEINHARIGRIRTFVKKVEAAIASGDKDAAKAAFQIAMPEVQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N ASRK+SRLS R+K I
Sbjct: 61 GVTKGVLHQNTASRKISRLSARIKAI 86


>gi|225873325|ref|YP_002754784.1| ribosomal protein S20 [Acidobacterium capsulatum ATCC 51196]
 gi|254813036|sp|C1F7F1|RS20_ACIC5 RecName: Full=30S ribosomal protein S20
 gi|225792186|gb|ACO32276.1| ribosomal protein S20 [Acidobacterium capsulatum ATCC 51196]
          Length = 91

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K  R+  R+T +N++ +S VR  +R   EAI  G ++ A E  +   S + K
Sbjct: 1  MANHVSSLKRARQTVRKTAVNRANKSRVRGSLRSLREAIQKGDVKAAQEQYKATASALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          +  KGI H N ASR  SRL+ R+K + T A
Sbjct: 61 SVQKGILHANTASRYKSRLNARVKALATQA 90


>gi|332186404|ref|ZP_08388149.1| ribosomal protein S20 [Sphingomonas sp. S17]
 gi|332013772|gb|EGI55832.1| ribosomal protein S20 [Sphingomonas sp. S17]
          Length = 87

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+  RR +IN +R S +R+F++    A+  G  E AT A   A+  + +
Sbjct: 1  MANTPQAKKRIRRNERRAVINGNRVSRIRTFVKKVEAALAAGDKETATVALAAAQPEMAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N  +RK SRL+KR+  +
Sbjct: 61 GVAKGVLHKNTVARKFSRLTKRIAAL 86


>gi|22096105|sp|Q8RB79|RS20_THETN RecName: Full=30S ribosomal protein S20
 gi|20515946|gb|AAM24199.1| Ribosomal protein S20 [Thermoanaerobacter tengcongensis MB4]
          Length = 105

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (58%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK I  I +RTL NK  +S V++F+R  NE++    IE   E  R A   + K
Sbjct: 13  LANTKSAKKRIAIIKKRTLRNKMIKSRVKTFIRRFNESLATKDIEAIKERLRLAVKELDK 72

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
           A SKG+ H N A+RK S+L  +   +L SA
Sbjct: 73  AVSKGVLHKNTAARKKSKLYAKFNALLKSA 102


>gi|126734085|ref|ZP_01749832.1| ribosomal protein S20 [Roseobacter sp. CCS2]
 gi|126716951|gb|EBA13815.1| ribosomal protein S20 [Roseobacter sp. CCS2]
          Length = 87

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK RRS +R+++R   EAI  G  + A  A + A+  + +
Sbjct: 1  MANSPQAKKRARQNEARFAVNKMRRSRIRTYLRAVEEAIASGDQKAAAAALKVAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+RK+SRLS R+K I
Sbjct: 61 GVTKGVMHKNTAARKMSRLSSRVKAI 86


>gi|117926699|ref|YP_867316.1| 30S ribosomal protein S20P [Magnetococcus sp. MC-1]
 gi|166223945|sp|A0LD67|RS20_MAGSM RecName: Full=30S ribosomal protein S20
 gi|117610455|gb|ABK45910.1| SSU ribosomal protein S20P [Magnetococcus sp. MC-1]
          Length = 92

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 55/90 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K IR+ A+RT+ N+  ++ +R+F +    A+  G +E A +  R A SVI +
Sbjct: 1  MANHKSALKRIRQSAKRTVANRIDKARMRTFAKKVLAAVEAGDVELAQQTLRDATSVISR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             +G+ H N ASR+++RL+  +K +  +A
Sbjct: 61 TAQRGVIHTNQASRRIARLNSHVKKLAVAA 90


>gi|320106119|ref|YP_004181709.1| 30S ribosomal protein S20 [Terriglobus saanensis SP1PR4]
 gi|319924640|gb|ADV81715.1| ribosomal protein S20 [Terriglobus saanensis SP1PR4]
          Length = 91

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K  R+   +T +N++ R+ +R  +R   E++  G  + A E  R   SV+ K
Sbjct: 1  MANHVSSLKRARQTVAKTAVNRANRTKLRGILRQMRESLVAGDAKSAAEQYRSTVSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          +  KG+ H N ASR  SRL+ RLK + T A
Sbjct: 61 SVQKGVLHANTASRYKSRLNARLKTLATKA 90


>gi|163847974|ref|YP_001636018.1| 30S ribosomal protein S20 [Chloroflexus aurantiacus J-10-fl]
 gi|222525855|ref|YP_002570326.1| 30S ribosomal protein S20 [Chloroflexus sp. Y-400-fl]
 gi|189044853|sp|A9WHB7|RS20_CHLAA RecName: Full=30S ribosomal protein S20
 gi|254813056|sp|B9LJI4|RS20_CHLSY RecName: Full=30S ribosomal protein S20
 gi|163669263|gb|ABY35629.1| ribosomal protein S20 [Chloroflexus aurantiacus J-10-fl]
 gi|222449734|gb|ACM54000.1| ribosomal protein S20 [Chloroflexus sp. Y-400-fl]
          Length = 94

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 2/86 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK IR  AR+ L N+S RS V++ ++ A  A+  G ++EA  A R A S + K
Sbjct: 1  MANTKSAKKRIRSDARKHLRNQSYRSRVKTMIKKAELALANGVVDEA--ALRMAYSTLDK 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N A+R+ SRL+++ K +
Sbjct: 59 AAVKGIIHKNNAARRKSRLAQKAKKV 84


>gi|219849835|ref|YP_002464268.1| 30S ribosomal protein S20 [Chloroflexus aggregans DSM 9485]
 gi|254813055|sp|B8G6M3|RS20_CHLAD RecName: Full=30S ribosomal protein S20
 gi|219544094|gb|ACL25832.1| ribosomal protein S20 [Chloroflexus aggregans DSM 9485]
          Length = 94

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 2/86 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK IR  AR+ L N+S RS V++ ++ A  A+  G ++EA  A R A S + K
Sbjct: 1  MANTKSAKKRIRSDARKRLRNQSYRSRVKTMIKKAELALANGIVDEA--ALRAAYSTLDK 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H N A+R+ SRL+++ K +
Sbjct: 59 AAVKGIIHKNNAARRKSRLAQKAKKV 84


>gi|289422290|ref|ZP_06424141.1| ribosomal protein S20 [Peptostreptococcus anaerobius 653-L]
 gi|289157295|gb|EFD05909.1| ribosomal protein S20 [Peptostreptococcus anaerobius 653-L]
          Length = 88

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++T +N+ R+S +++ ++  ++A+  G  EEA    + A+  I +
Sbjct: 1  MANIKSAKKRISVIEKKTALNRVRKSQIKTAIKRFDDAVVAGNKEEAQAKFQTAQKKIYQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG  H NAA RKVS+L+ RL  +
Sbjct: 61 VASKGTIHKNAADRKVSKLANRLNAM 86


>gi|71066042|ref|YP_264769.1| 30S ribosomal protein S20 [Psychrobacter arcticus 273-4]
 gi|115305703|sp|Q4FRM3|RS20_PSYA2 RecName: Full=30S ribosomal protein S20
 gi|71039027|gb|AAZ19335.1| SSU ribosomal protein S20P [Psychrobacter arcticus 273-4]
          Length = 88

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   + S+RS VR++++  + AI     + ATEA +KA  V+ +
Sbjct: 1  MANTAQARKRARQNTKRRQNSASQRSMVRTYLKRVDAAIAAKDYDAATEAYKKAVPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R+ SRL+K +KG+
Sbjct: 61 MADKGILHKNKAARRKSRLNKTIKGL 86


>gi|163733261|ref|ZP_02140705.1| 30S ribosomal protein S20 [Roseobacter litoralis Och 149]
 gi|161393796|gb|EDQ18121.1| 30S ribosomal protein S20 [Roseobacter litoralis Och 149]
          Length = 87

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 53/84 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R  +NK+RRS +R+F+R   EAI  G    AT A R A+  + +
Sbjct: 1  MANSPQAKKRARQNEARFQVNKARRSRIRTFLRKVEEAIESGDKAAATAALRAAQPELMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +KG+FH N A+RK+SRL+ R+K
Sbjct: 61 GVTKGVFHKNTAARKMSRLTARVK 84


>gi|307244333|ref|ZP_07526447.1| ribosomal protein S20 [Peptostreptococcus stomatis DSM 17678]
 gi|306492299|gb|EFM64338.1| ribosomal protein S20 [Peptostreptococcus stomatis DSM 17678]
          Length = 88

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++T +N+ R+S +++ ++  +EA+  G  EEA    + A+  I +
Sbjct: 1  MANIKSAKKRIGVIEKKTALNRVRKSQIKTAIKRFDEAVVAGNKEEAQAKFQLAQKKIYQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            SKG  H NAA RKVS+L+ RL
Sbjct: 61 VASKGTIHKNAADRKVSKLANRL 83


>gi|229828444|ref|ZP_04454513.1| hypothetical protein GCWU000342_00505 [Shuttleworthia satelles
          DSM 14600]
 gi|229793038|gb|EEP29152.1| hypothetical protein GCWU000342_00505 [Shuttleworthia satelles
          DSM 14600]
          Length = 87

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +   A +T  NK+ +S V+++++  + A+     + A  A ++A SVI +
Sbjct: 1  MANIKSAKKRVLVTATKTARNKAIKSEVKTYIKKVDAAVEAEDKDAALAALKEATSVIAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG++H N A+RKVSRLSK
Sbjct: 61 ACSKGVYHKNTAARKVSRLSK 81


>gi|317471378|ref|ZP_07930732.1| ribosomal protein S20 [Anaerostipes sp. 3_2_56FAA]
 gi|316901129|gb|EFV23089.1| ribosomal protein S20 [Anaerostipes sp. 3_2_56FAA]
          Length = 87

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I  +T  NK+ ++ V++++++   A+  G    A EA     S I K
Sbjct: 1  MANIKSAKKRILVINTKTERNKAIKTKVKTYIKNVEAAVAAGDKTAANEALTACISEINK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGIFH N A+RKVSRL+K +  +
Sbjct: 61 AASKGIFHKNTAARKVSRLTKAVNSV 86


>gi|77464919|ref|YP_354423.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides 2.4.1]
 gi|126460788|ref|YP_001041902.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides ATCC 17029]
 gi|221640840|ref|YP_002527102.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides KD131]
 gi|332559818|ref|ZP_08414140.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides WS8N]
 gi|124056505|sp|Q3IY62|RS20_RHOS4 RecName: Full=30S ribosomal protein S20
 gi|166223975|sp|A3PFL4|RS20_RHOS1 RecName: Full=30S ribosomal protein S20
 gi|254813086|sp|B9KQK1|RS20_RHOSK RecName: Full=30S ribosomal protein S20
 gi|77389337|gb|ABA80522.1| SSU ribosomal protein S20P [Rhodobacter sphaeroides 2.4.1]
 gi|126102452|gb|ABN75130.1| SSU ribosomal protein S20P [Rhodobacter sphaeroides ATCC 17029]
 gi|221161621|gb|ACM02601.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides KD131]
 gi|332277530|gb|EGJ22845.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides WS8N]
          Length = 92

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+   R  +NK+RRS +R+F+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANSPQSKKRARQAEARAAVNKARRSRIRTFLRKVEEAIATGDASVAAAALKTAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            +KG+ H N  +RK+SRL+ R+K
Sbjct: 61 GVTKGVLHKNTVARKMSRLAHRVK 84


>gi|149186375|ref|ZP_01864688.1| ribosomal protein S20 [Erythrobacter sp. SD-21]
 gi|148829964|gb|EDL48402.1| ribosomal protein S20 [Erythrobacter sp. SD-21]
          Length = 86

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+  RR  IN +R S +R F++    A   G  + A  A + A+  + +
Sbjct: 1  MANTPQAKKRIRRNTRRAEINGARMSRIRGFVKKVETACEAGDKDAAQTALKNAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N ASRK+SRL+KR+  +
Sbjct: 61 GVARGVMHKNTASRKLSRLTKRVAAL 86


>gi|89056703|ref|YP_512154.1| 30S ribosomal protein S20 [Jannaschia sp. CCS1]
 gi|118573822|sp|Q28JI3|RS20_JANSC RecName: Full=30S ribosomal protein S20
 gi|88866252|gb|ABD57129.1| SSU ribosomal protein S20P [Jannaschia sp. CCS1]
          Length = 88

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  RR  INK+RRS +R+ +R   EAI  G    AT A + A+  + +
Sbjct: 1  MANSPQAKKRARQNERRFAINKARRSRIRTHLRTVEEAIASGDQAAATAALKAAQPEMMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+RK+SRLS R+K +
Sbjct: 61 GVTKGVMHKNTAARKMSRLSSRVKAL 86


>gi|126700090|ref|YP_001088987.1| 30S ribosomal protein S20 [Clostridium difficile 630]
 gi|254976068|ref|ZP_05272540.1| 30S ribosomal protein S20 [Clostridium difficile QCD-66c26]
 gi|255093459|ref|ZP_05322937.1| 30S ribosomal protein S20 [Clostridium difficile CIP 107932]
 gi|255101634|ref|ZP_05330611.1| 30S ribosomal protein S20 [Clostridium difficile QCD-63q42]
 gi|255307503|ref|ZP_05351674.1| 30S ribosomal protein S20 [Clostridium difficile ATCC 43255]
 gi|255315201|ref|ZP_05356784.1| 30S ribosomal protein S20 [Clostridium difficile QCD-76w55]
 gi|255517870|ref|ZP_05385546.1| 30S ribosomal protein S20 [Clostridium difficile QCD-97b34]
 gi|255656456|ref|ZP_05401865.1| 30S ribosomal protein S20 [Clostridium difficile QCD-23m63]
 gi|260687714|ref|YP_003218848.1| 30S ribosomal protein S20 [Clostridium difficile R20291]
 gi|306520858|ref|ZP_07407205.1| 30S ribosomal protein S20 [Clostridium difficile QCD-32g58]
 gi|118573812|sp|Q182G1|RS20_CLOD6 RecName: Full=30S ribosomal protein S20
 gi|115251527|emb|CAJ69360.1| 30S ribosomal protein S20 [Clostridium difficile]
 gi|260213731|emb|CBE05633.1| 30S ribosomal protein S20 [Clostridium difficile R20291]
          Length = 88

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++T +N+ R+S +++ +R   +A+  G  E+A    + A+  I +
Sbjct: 1  MANIKSAKKRISVIEKKTALNRVRKSQIKTAIRRFEDAVAAGNREDAVAKFQYAQKRIYQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG  H NAA+RKV++L+++L G+
Sbjct: 61 VASKGTIHKNAAARKVAKLAQKLNGM 86


>gi|222475593|ref|YP_002564010.1| 30S ribosomal protein S20 (rpsT) [Anaplasma marginale str.
          Florida]
 gi|56388461|gb|AAV87048.1| 30S ribosomal protein S20 [Anaplasma marginale str. St. Maries]
 gi|222419731|gb|ACM49754.1| 30S ribosomal protein S20 (rpsT) [Anaplasma marginale str.
          Florida]
          Length = 106

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFGKIEEATEACRKAESVIQ 59
          M N  SAKKM+R I  RT  N+ R+S VR+ ++     + + G +E+A  A R AES I 
Sbjct: 11 MPNHSSAKKMVRVIKERTFSNRVRKSRVRNSVKKFLAVLESKGHLEDAVTAFRAAESNIH 70

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGI 86
          K  +KG+ H N A+RKV  L+ +LK  
Sbjct: 71 KCVNKGVMHRNTAARKVKSLAAKLKAF 97


>gi|269958381|ref|YP_003328168.1| 30S ribosomal protein S20 [Anaplasma centrale str. Israel]
 gi|269848210|gb|ACZ48854.1| 30S ribosomal protein S20 [Anaplasma centrale str. Israel]
          Length = 96

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFGKIEEATEACRKAESVIQ 59
          M N  SAKKM+R I  RT  N+ R+S VR+ ++     + + G IE+A  A R AES I 
Sbjct: 1  MPNHSSAKKMVRVIKERTFSNRVRKSRVRNSVKKFLAVLESKGHIEDAVTAFRVAESNIH 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGI 86
          K  +KG+ H N A+RKV  L+ +LK  
Sbjct: 61 KCVNKGVMHRNTAARKVKALAAKLKAF 87


>gi|161544978|ref|YP_154303.2| 30S ribosomal protein S20 [Anaplasma marginale str. St. Maries]
 gi|254995397|ref|ZP_05277587.1| 30S ribosomal protein S20 [Anaplasma marginale str. Mississippi]
 gi|255003584|ref|ZP_05278548.1| 30S ribosomal protein S20 [Anaplasma marginale str. Puerto Rico]
 gi|255004715|ref|ZP_05279516.1| 30S ribosomal protein S20 [Anaplasma marginale str. Virginia]
 gi|62510989|sp|Q5P9I2|RS20_ANAMM RecName: Full=30S ribosomal protein S20
          Length = 96

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFGKIEEATEACRKAESVIQ 59
          M N  SAKKM+R I  RT  N+ R+S VR+ ++     + + G +E+A  A R AES I 
Sbjct: 1  MPNHSSAKKMVRVIKERTFSNRVRKSRVRNSVKKFLAVLESKGHLEDAVTAFRAAESNIH 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGI 86
          K  +KG+ H N A+RKV  L+ +LK  
Sbjct: 61 KCVNKGVMHRNTAARKVKSLAAKLKAF 87


>gi|144900241|emb|CAM77105.1| 30S ribosomal protein S20 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK IR+  RRT +N +R S +R+F++    AI  G  EEA  A   A+  + K
Sbjct: 1  MAHHQSAKKRIRQTERRTEVNGARVSRIRTFVKKVELAIAGGNAEEAKAALAAAQPELIK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
              G+ H N ASRKVSRL+ R+K +L  A
Sbjct: 61 GAQAGVLHKNTASRKVSRLAARVKSMLPLA 90


>gi|198283953|ref|YP_002220274.1| 30S ribosomal protein S20 [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|218667755|ref|YP_002426587.1| ribosomal protein S20 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226735284|sp|B7J5H6|RS20_ACIF2 RecName: Full=30S ribosomal protein S20
 gi|226735285|sp|B5EKY1|RS20_ACIF5 RecName: Full=30S ribosomal protein S20
 gi|198248474|gb|ACH84067.1| ribosomal protein S20 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519968|gb|ACK80554.1| ribosomal protein S20 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 91

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K + +  +R L N S RS +R++++   +A+  G  E+A  A R AESVI K
Sbjct: 1  MANTAQARKRVLQNEKRRLHNASLRSRLRTYVKGVLKAVHVGDQEQARSALRAAESVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KG+ H N A+R  SRLS R+K +  +A
Sbjct: 61 TVGKGVAHRNMAARTKSRLSARVKAMGNAA 90


>gi|299139984|ref|ZP_07033154.1| ribosomal protein S20 [Acidobacterium sp. MP5ACTX8]
 gi|298597984|gb|EFI54152.1| ribosomal protein S20 [Acidobacterium sp. MP5ACTX8]
          Length = 91

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K  R+   +T IN++ +S +R  +R   EAI  G  + ATEA R   S++ K
Sbjct: 1  MANHVSSLKRARQTLTKTAINRANKSKLRGTLRAMREAIAGGDHKSATEAYRSTASILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          +  KGI H N ASR   RL+ R+K ++
Sbjct: 61 SVQKGILHKNTASRYKGRLNARVKALV 87


>gi|161594524|ref|YP_359267.2| 30S ribosomal protein S20 [Carboxydothermus hydrogenoformans
          Z-2901]
          Length = 90

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I +RT+ NK+ RS+V++ ++    A+     EEA E  R+A   + K
Sbjct: 1  MANTKSAKKRILIIRKRTMRNKAIRSAVKTAIKKFEMALKVKPAEEARELLRQAVRALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRK SRL+++   +
Sbjct: 61 AVTKGVIHKNTASRKKSRLTRKFNSV 86


>gi|313905054|ref|ZP_07838424.1| ribosomal protein S20 [Eubacterium cellulosolvens 6]
 gi|313470124|gb|EFR65456.1| ribosomal protein S20 [Eubacterium cellulosolvens 6]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     R   N++ +S+V++ ++    AI  G  E A  A   A S I K
Sbjct: 1  MANIKSAKKRILVTKTRAARNQAEKSAVKTSIKKVEAAIAAGDKEAAKSALIAATSKIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A+SKGIFH N A+RKVSRLSK +  I
Sbjct: 61 AESKGIFHKNNAARKVSRLSKAVNSI 86


>gi|167746552|ref|ZP_02418679.1| hypothetical protein ANACAC_01262 [Anaerostipes caccae DSM 14662]
 gi|167653512|gb|EDR97641.1| hypothetical protein ANACAC_01262 [Anaerostipes caccae DSM 14662]
          Length = 116

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 52/86 (60%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK I  I  +T  NK+ ++ V++++++   A+  G    A EA     S I K
Sbjct: 30  LANIKSAKKRILVINTKTERNKAIKTKVKTYIKNVEAAVAAGDKTAANEALTACISEINK 89

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A SKGIFH N A+RKVSRL+K +  +
Sbjct: 90  AASKGIFHKNTAARKVSRLTKAVNSV 115


>gi|56552254|ref|YP_163093.1| 30S ribosomal protein S20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761681|ref|ZP_04759768.1| ribosomal protein S20 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|260754045|ref|YP_003226938.1| 30S ribosomal protein S20 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|7388183|sp|Q9Z5V0|RS20_ZYMMO RecName: Full=30S ribosomal protein S20
 gi|4378842|gb|AAD19710.1| 30S ribosomal protein S20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543828|gb|AAV89982.1| ribosomal protein S20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373989|gb|EER63522.1| ribosomal protein S20 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|258553408|gb|ACV76354.1| ribosomal protein S20 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+  RR  IN +R + +R+F++    AI  G   EA  A   A+  + +
Sbjct: 1  MANTPQAKKRIRRNDRRAEINGNRVNRIRTFIKKVESAIAAGNKSEAETALASAQPELFR 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            SKG+ H N ASRK SRL+K
Sbjct: 61 GVSKGVLHKNTASRKFSRLAK 81


>gi|255020926|ref|ZP_05292982.1| SSU ribosomal protein S20p [Acidithiobacillus caldus ATCC 51756]
 gi|254969717|gb|EET27223.1| SSU ribosomal protein S20p [Acidithiobacillus caldus ATCC 51756]
          Length = 91

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K + +   R   N S RS +R++++   +A+  G  E+A  A  +AES+I K
Sbjct: 1  MANSAQARKRVLQNENRRRHNASLRSRMRTYVKSVLKAVREGDQEQARRALHQAESIIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            SKGI H N A+R  SRLS R+K + T+
Sbjct: 61 TASKGIVHANTAARTKSRLSARVKALGTA 89


>gi|160893075|ref|ZP_02073863.1| hypothetical protein CLOL250_00620 [Clostridium sp. L2-50]
 gi|156865158|gb|EDO58589.1| hypothetical protein CLOL250_00620 [Clostridium sp. L2-50]
          Length = 87

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 48/80 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++TL NK  +S V++ ++    AI  G  E A      A S I K
Sbjct: 1  MANIKSAKKRIEVIDKKTLRNKMIKSKVKTVIKKVEAAIAAGDKEAAQANLLVAISEIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG++H N ASRKVSRL+
Sbjct: 61 AASKGVYHKNNASRKVSRLT 80


>gi|167626943|ref|YP_001677443.1| 30S ribosomal protein S20 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241667520|ref|ZP_04755098.1| 30S ribosomal protein S20 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254876066|ref|ZP_05248776.1| 30S ribosomal protein S20 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|189044864|sp|B0TW34|RS20_FRAP2 RecName: Full=30S ribosomal protein S20
 gi|167596944|gb|ABZ86942.1| ribosomal protein S20 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254842087|gb|EET20501.1| 30S ribosomal protein S20 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 90

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK I +  R    N +RRS +R+F++ A  AI  G +E A E   K   ++ K
Sbjct: 1  MANSKQAKKRIIQAERNRQHNVARRSMMRTFLKKAAYAIEKGDVEAAKENFAKVVPILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKG+ H N A+R  SRLS ++K + T+A
Sbjct: 61 YASKGLIHKNKAARHKSRLSAKIKALSTAA 90


>gi|226323241|ref|ZP_03798759.1| hypothetical protein COPCOM_01013 [Coprococcus comes ATCC 27758]
 gi|225208431|gb|EEG90785.1| hypothetical protein COPCOM_01013 [Coprococcus comes ATCC 27758]
          Length = 87

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +T  NK+ +S V+++++    A+    +E A  A ++A SVI K
Sbjct: 1  MANIKSAKKRILVTETKTARNKAIKSKVKTYVKKVETAVEKKDVEAAKVALKEAISVINK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N  +RK+SRL+K +  I
Sbjct: 61 AGSKGVYHKNTCARKISRLTKAVNEI 86


>gi|302534350|ref|ZP_07286692.1| ribosomal protein S20 [Streptomyces sp. C]
 gi|302443245|gb|EFL15061.1| ribosomal protein S20 [Streptomyces sp. C]
          Length = 86

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 44/68 (64%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NKS +S +R+F+R ANEAI  G  E+AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKSVKSELRTFIRKANEAILAGDAEKATAAARLASKKLDKAVSKGVIHKNAAANKKSA 78

Query: 79 LSKRLKGI 86
          L+ ++  I
Sbjct: 79 LATKVAAI 86


>gi|146296060|ref|YP_001179831.1| ribosomal protein S20 [Caldicellulosiruptor saccharolyticus DSM
          8903]
 gi|166223918|sp|A4XIA5|RS20_CALS8 RecName: Full=30S ribosomal protein S20
 gi|145409636|gb|ABP66640.1| SSU ribosomal protein S20P [Caldicellulosiruptor saccharolyticus
          DSM 8903]
          Length = 99

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I RRT+ NK ++  ++  ++   +A+  G IE+A E   KA  +I +
Sbjct: 1  MANTKSAKKKIKVIRRRTIENKIQKFKMKKAIKEVKKALLAGDIEKAKELYSKAAKLIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            +KG+ H N ASRK SRL K
Sbjct: 61 TAAKGVIHKNNASRKKSRLMK 81


>gi|110833317|ref|YP_692176.1| 30S ribosomal protein S20 [Alcanivorax borkumensis SK2]
 gi|118573806|sp|Q0VSE4|RS20_ALCBS RecName: Full=30S ribosomal protein S20
 gi|110646428|emb|CAL15904.1| 30S ribosomal protein S20 [Alcanivorax borkumensis SK2]
          Length = 88

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N + RS VR++++  N AI  G    A EA  +A SV+ K
Sbjct: 1  MANSPQARKRARQAENRRQHNAAMRSMVRTYLKKVNAAIASGDQGSAQEAYNQAVSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG FH N A+R  SRL+ ++K +
Sbjct: 61 ATRKGKFHPNKAARHKSRLNTKIKAM 86


>gi|222529898|ref|YP_002573780.1| 30S ribosomal protein S20 [Caldicellulosiruptor bescii DSM 6725]
 gi|302872356|ref|YP_003840992.1| ribosomal protein S20 [Caldicellulosiruptor obsidiansis OB47]
 gi|312127090|ref|YP_003991964.1| 30S ribosomal protein S20 [Caldicellulosiruptor hydrothermalis
          108]
 gi|312135643|ref|YP_004002981.1| 30S ribosomal protein S20 [Caldicellulosiruptor owensensis OL]
 gi|312621884|ref|YP_004023497.1| 30S ribosomal protein S20 [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312792994|ref|YP_004025917.1| 30S ribosomal protein S20 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312876462|ref|ZP_07736446.1| ribosomal protein S20 [Caldicellulosiruptor lactoaceticus 6A]
 gi|254813040|sp|B9MKZ9|RS20_ANATD RecName: Full=30S ribosomal protein S20
 gi|222456745|gb|ACM61007.1| ribosomal protein S20 [Caldicellulosiruptor bescii DSM 6725]
 gi|302575215|gb|ADL43006.1| ribosomal protein S20 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775694|gb|ADQ05181.1| ribosomal protein S20 [Caldicellulosiruptor owensensis OL]
 gi|311777109|gb|ADQ06595.1| ribosomal protein S20 [Caldicellulosiruptor hydrothermalis 108]
 gi|311796820|gb|EFR13165.1| ribosomal protein S20 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180134|gb|ADQ40304.1| ribosomal protein S20 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312202351|gb|ADQ45678.1| ribosomal protein S20 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 99

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I RRT+ NK ++  ++  ++   +A+  G IE+A E   KA  +I +
Sbjct: 1  MANTKSAKKKIKVIRRRTIENKIQKFKMKKAIKEVKKALLSGDIEKAKELYSKAAKLIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            +KG+ H N ASRK SRL K
Sbjct: 61 TAAKGVIHKNNASRKKSRLMK 81


>gi|296450098|ref|ZP_06891860.1| 30S ribosomal protein S20 [Clostridium difficile NAP08]
 gi|296878479|ref|ZP_06902485.1| 30S ribosomal protein S20 [Clostridium difficile NAP07]
 gi|296261106|gb|EFH07939.1| 30S ribosomal protein S20 [Clostridium difficile NAP08]
 gi|296430563|gb|EFH16404.1| 30S ribosomal protein S20 [Clostridium difficile NAP07]
          Length = 100

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 55/86 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I  I ++T +N+ R+S +++ +R   +A+  G  E+A    + A+  I +
Sbjct: 13 VANIKSAKKRISVIEKKTALNRVRKSQIKTAIRRFEDAVAAGNREDAVAKFQYAQKRIYQ 72

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG  H NAA+RKV++L+++L G+
Sbjct: 73 VASKGTIHKNAAARKVAKLAQKLNGM 98


>gi|260684054|ref|YP_003215339.1| 30S ribosomal protein S20 [Clostridium difficile CD196]
 gi|260210217|emb|CBA64445.1| 30S ribosomal protein S20 [Clostridium difficile CD196]
          Length = 102

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++T +N+ R+S +++ +R   +A+  G  E+A    + A+  I +
Sbjct: 1  MANIKSAKKRISVIEKKTALNRVRKSQIKTAIRRFEDAVAAGNREDAVAKFQYAQKRIYQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            SKG  H NAA+RKV++L++++K
Sbjct: 61 VASKGTIHKNAAARKVAKLAQKIK 84


>gi|326570221|gb|EGE20266.1| 30S ribosomal protein S20 [Moraxella catarrhalis BC8]
          Length = 88

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S+RS VR++++  N AI     E ATEA  KA  VI +
Sbjct: 1  MANSAQARKRARQNTKRRQHNASQRSMVRTYIKRVNSAIEAKSYELATEAYNKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+  +K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNTAIKAL 86


>gi|208780008|ref|ZP_03247351.1| ribosomal protein S20 [Francisella novicida FTG]
 gi|208744012|gb|EDZ90313.1| ribosomal protein S20 [Francisella novicida FTG]
          Length = 90

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK I +  R    N +RRS +R+F++    AI  G +E A E   K   ++ K
Sbjct: 1  MANSKQAKKRIVQAERNRQHNVARRSMMRTFLKKTAYAIEKGDVEAAKENFAKVVPILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKG+ H N A+R  SRLS ++K + T+A
Sbjct: 61 YASKGLIHKNKAARHKSRLSAKIKALATAA 90


>gi|296113281|ref|YP_003627219.1| 30S ribosomal protein S20 [Moraxella catarrhalis RH4]
 gi|295920975|gb|ADG61326.1| 30S ribosomal protein S20 [Moraxella catarrhalis RH4]
 gi|326560269|gb|EGE10657.1| 30S ribosomal protein S20 [Moraxella catarrhalis 7169]
 gi|326561964|gb|EGE12297.1| 30S ribosomal protein S20 [Moraxella catarrhalis 46P47B1]
 gi|326563647|gb|EGE13899.1| 30S ribosomal protein S20 [Moraxella catarrhalis 103P14B1]
 gi|326565274|gb|EGE15459.1| 30S ribosomal protein S20 [Moraxella catarrhalis 12P80B1]
 gi|326566413|gb|EGE16563.1| 30S ribosomal protein S20 [Moraxella catarrhalis BC1]
 gi|326570958|gb|EGE20982.1| 30S ribosomal protein S20 [Moraxella catarrhalis BC7]
 gi|326573254|gb|EGE23222.1| 30S ribosomal protein S20 [Moraxella catarrhalis 101P30B1]
 gi|326575845|gb|EGE25768.1| 30S ribosomal protein S20 [Moraxella catarrhalis CO72]
 gi|326576929|gb|EGE26835.1| 30S ribosomal protein S20 [Moraxella catarrhalis O35E]
          Length = 88

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S+RS VR++++  N AI     E ATEA  KA  VI +
Sbjct: 1  MANSAQARKRARQNTKRRQHNASQRSMVRTYIKRVNSAIEAKSYELATEAYNKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+  +K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAAIKAL 86


>gi|89255513|ref|YP_512874.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica LVS]
 gi|115314032|ref|YP_762755.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|156501447|ref|YP_001427512.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|167010286|ref|ZP_02275217.1| ribosomal protein S20 [Francisella tularensis subsp. holarctica
          FSC200]
 gi|254366941|ref|ZP_04982978.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica 257]
 gi|290954258|ref|ZP_06558879.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312322|ref|ZP_06803109.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|118573820|sp|Q2A5X7|RS20_FRATH RecName: Full=30S ribosomal protein S20
 gi|122325905|sp|Q0BP66|RS20_FRATO RecName: Full=30S ribosomal protein S20
 gi|166223935|sp|A7N9A3|RS20_FRATF RecName: Full=30S ribosomal protein S20
 gi|89143344|emb|CAJ78511.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica LVS]
 gi|115128931|gb|ABI82118.1| ribosomal protein S20 [Francisella tularensis subsp. holarctica
          OSU18]
 gi|134252768|gb|EBA51862.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica 257]
 gi|156252050|gb|ABU60556.1| ribosomal protein S20 [Francisella tularensis subsp. holarctica
          FTNF002-00]
          Length = 90

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK I +  R    N +RRS +R+F++    AI  G +E A E   K   ++ K
Sbjct: 1  MANSKQAKKRIIQAERNRQHNVARRSMMRTFLKKTAYAIEKGDVEAAKENFTKVVPILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKG+ H N A+R  SRLS ++K + T+A
Sbjct: 61 YASKGLIHKNKAARHKSRLSAKIKALATAA 90


>gi|163816657|ref|ZP_02208020.1| hypothetical protein COPEUT_02847 [Coprococcus eutactus ATCC
          27759]
 gi|158447914|gb|EDP24909.1| hypothetical protein COPEUT_02847 [Coprococcus eutactus ATCC
          27759]
          Length = 92

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I  I ++TL NK  +S V++ ++    AI  G    A +A   A S I K
Sbjct: 6  LANIKSAKKRINVIEKKTLRNKMIKSKVKTVIKKVEAAIAAGDKVAAQQALVVATSEINK 65

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKGI+H N A+RKVSRL+
Sbjct: 66 AASKGIYHKNNAARKVSRLA 85


>gi|23014787|ref|ZP_00054587.1| COG0268: Ribosomal protein S20 [Magnetospirillum magnetotacticum
          MS-1]
          Length = 90

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 49/84 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK IR+   RT +N++R S +R+F++    AI  G    A  A + A+  + K
Sbjct: 1  MAHHKSAKKRIRQTETRTEVNRARVSRIRTFVKKVELAIAGGDSAAAQAALKDAQPELMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
              G+ H N ASRKVSRL  R+K
Sbjct: 61 GAQAGVLHKNTASRKVSRLVARVK 84


>gi|90111920|sp|Q3AF17|RS20_CARHZ RecName: Full=30S ribosomal protein S20
 gi|77996512|gb|ABB15411.1| ribosomal protein S20 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 93

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I  I +RT+ NK+ RS+V++ ++    A+     EEA E  R+A   + K
Sbjct: 4  VANTKSAKKRILIIRKRTMRNKAIRSAVKTAIKKFEMALKVKPAEEARELLRQAVRALDK 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRK SRL+++   +
Sbjct: 64 AVTKGVIHKNTASRKKSRLTRKFNSV 89


>gi|56708689|ref|YP_170585.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110671161|ref|YP_667718.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118496721|ref|YP_897771.1| 30S ribosomal protein S20 [Francisella tularensis subsp. novicida
          U112]
 gi|134302733|ref|YP_001122701.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|187930948|ref|YP_001890932.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|194324028|ref|ZP_03057803.1| ribosomal protein S20 [Francisella tularensis subsp. novicida
          FTE]
 gi|224457898|ref|ZP_03666371.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254368477|ref|ZP_04984494.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|254371320|ref|ZP_04987322.1| hypothetical protein [Francisella tularensis subsp. tularensis
          FSC033]
 gi|254372087|ref|ZP_04987580.1| ribosomal protein S20 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254375235|ref|ZP_04990715.1| hypothetical protein FTDG_01426 [Francisella novicida GA99-3548]
 gi|254875564|ref|ZP_05248274.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|62510987|sp|Q5NEF7|RS20_FRATT RecName: Full=30S ribosomal protein S20
 gi|122970835|sp|Q14FW0|RS20_FRAT1 RecName: Full=30S ribosomal protein S20
 gi|166223936|sp|A0Q452|RS20_FRATN RecName: Full=30S ribosomal protein S20
 gi|166223937|sp|A4J079|RS20_FRATW RecName: Full=30S ribosomal protein S20
 gi|226736499|sp|B2SEJ5|RS20_FRATM RecName: Full=30S ribosomal protein S20
 gi|54112607|gb|AAV28937.1| NT02FT1562 [synthetic construct]
 gi|56605181|emb|CAG46312.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110321494|emb|CAL09695.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118422627|gb|ABK89017.1| ribosomal protein S20 [Francisella novicida U112]
 gi|134050510|gb|ABO47581.1| ribosomal protein S20 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|151569560|gb|EDN35214.1| hypothetical protein FTBG_01102 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|151569818|gb|EDN35472.1| ribosomal protein S20 [Francisella novicida GA99-3549]
 gi|151572953|gb|EDN38607.1| hypothetical protein FTDG_01426 [Francisella novicida GA99-3548]
 gi|157121371|gb|EDO65572.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|187711857|gb|ACD30154.1| ribosomal protein S20 [Francisella tularensis subsp. mediasiatica
          FSC147]
 gi|194321925|gb|EDX19408.1| ribosomal protein S20 [Francisella tularensis subsp. novicida
          FTE]
 gi|254841563|gb|EET19999.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282159940|gb|ADA79331.1| 30S ribosomal protein S20 [Francisella tularensis subsp.
          tularensis NE061598]
 gi|328675271|gb|AEB27946.1| SSU ribosomal protein S20p [Francisella cf. novicida 3523]
 gi|328676176|gb|AEB27046.1| SSU ribosomal protein S20p [Francisella cf. novicida Fx1]
          Length = 90

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK I +  R    N +RRS +R+F++    AI  G +E A E   K   ++ K
Sbjct: 1  MANSKQAKKRIIQAERNRQHNVARRSMMRTFLKKTAYAIEKGDVEAAKENFAKVVPILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKG+ H N A+R  SRLS ++K + T+A
Sbjct: 61 YASKGLIHKNKAARHKSRLSAKIKALATAA 90


>gi|116749518|ref|YP_846205.1| 30S ribosomal protein S20 [Syntrophobacter fumaroxidans MPOB]
 gi|166223995|sp|A0LK18|RS20_SYNFM RecName: Full=30S ribosomal protein S20
 gi|116698582|gb|ABK17770.1| SSU ribosomal protein S20P [Syntrophobacter fumaroxidans MPOB]
          Length = 86

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+   R + N++R++ +++ +R   EAI     E A E  + A SVI  
Sbjct: 1  MANHKSALKRARQNEERRIRNRARKTRMKNVIRSLEEAIASNSRETALERLKMAVSVIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            S+G+ H N ASRKV+RLSKR+  +
Sbjct: 61 TASRGVIHKNTASRKVARLSKRVNAL 86


>gi|146276059|ref|YP_001166218.1| 30S ribosomal protein S20 [Rhodobacter sphaeroides ATCC 17025]
 gi|166223976|sp|A4WNE9|RS20_RHOS5 RecName: Full=30S ribosomal protein S20
 gi|145554300|gb|ABP68913.1| ribosomal protein S20 [Rhodobacter sphaeroides ATCC 17025]
          Length = 92

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+   R  +NK+RRS +R+F+R   EAI  G    A  A + A+  + +
Sbjct: 1  MANSPQSKKRARQAEARAAVNKARRSRIRTFLRKVEEAIASGDPAAAAAALKTAQPEMAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +KG+ H N  +RK+SRL+ R+K +   A
Sbjct: 61 GVTKGVLHKNTVARKMSRLAHRVKVLSVPA 90


>gi|225175087|ref|ZP_03729083.1| ribosomal protein S20 [Dethiobacter alkaliphilus AHT 1]
 gi|225169263|gb|EEG78061.1| ribosomal protein S20 [Dethiobacter alkaliphilus AHT 1]
          Length = 93

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N   A K +R  ARRT  N+  +SSV++ +R   + +  G +  A++  + A   I K
Sbjct: 1  MPNTKQALKRMRVTARRTARNRHVKSSVKTAVRRFGDTLDQGDLNTASDKLQAAVKNIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H NAA+RK SRL+KRL
Sbjct: 61 AVSKGVVHKNAAARKKSRLAKRL 83


>gi|39997304|ref|NP_953255.1| 30S ribosomal protein S20 [Geobacter sulfurreducens PCA]
 gi|59798801|sp|Q74AZ3|RS20_GEOSL RecName: Full=30S ribosomal protein S20
 gi|39984195|gb|AAR35582.1| ribosomal protein S20 [Geobacter sulfurreducens PCA]
 gi|298506242|gb|ADI84965.1| ribosomal protein S20 [Geobacter sulfurreducens KN400]
          Length = 87

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 51/81 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SA K I++  ++ L NK  RS++R+F++   EA+     ++A +A   A  VI K
Sbjct: 1  MAHHKSALKRIKQNKKKYLRNKHIRSTLRTFIKRVREAVEAKNADQARQALLAAIPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H + ASR VSRL+K
Sbjct: 61 AASKGVIHASNASRNVSRLTK 81


>gi|218288645|ref|ZP_03492922.1| ribosomal protein S20 [Alicyclobacillus acidocaldarius LAA1]
 gi|258511972|ref|YP_003185406.1| 30S ribosomal protein S20 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|218241302|gb|EED08477.1| ribosomal protein S20 [Alicyclobacillus acidocaldarius LAA1]
 gi|257478698|gb|ACV59017.1| ribosomal protein S20 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 95

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +    R TL N+S +S++R+ +R    A     +EEA    R A   + K
Sbjct: 1  MANIKSAKKRVLITKRNTLRNRSIKSALRTHIRKFEAAFAAQDVEEAQARLRTALRALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A +KG+ H N A+RK SRL+KR   +L
Sbjct: 61 AVTKGVIHRNTAARKKSRLAKRFNALL 87


>gi|255650986|ref|ZP_05397888.1| 30S ribosomal protein S20 [Clostridium difficile QCD-37x79]
          Length = 102

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  I ++T +N+ R+S +++ +R   +A+  G  E+A    + A+  I +
Sbjct: 1  MANIKSAKKRISVIEKKTALNRVRKSQIKTAIRRFEDAVAAGNREDAVAKFQYAQKRIYQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
            SKG  H NAA+RKV++L+ ++K
Sbjct: 61 VASKGTIHKNAAARKVAKLATKIK 84


>gi|288818133|ref|YP_003432481.1| ribosomal protein S20 [Hydrogenobacter thermophilus TK-6]
 gi|288787533|dbj|BAI69280.1| ribosomal protein S20 [Hydrogenobacter thermophilus TK-6]
 gi|308751734|gb|ADO45217.1| ribosomal protein S20 [Hydrogenobacter thermophilus TK-6]
          Length = 95

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N   A+K +R+ A+R L N+   S +R++++     +  GK+EEA +   +  SV+  
Sbjct: 1  MPNTKQAEKRMRRDAKRRLRNRYHLSRMRTYIKKFRRMVQEGKLEEAKQFLPEVISVVYH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKG+ H N ASR+ SRLS  L   L SA
Sbjct: 61 TASKGVIHKNEASRRASRLSTLLNKALKSA 90


>gi|160933659|ref|ZP_02081047.1| hypothetical protein CLOLEP_02520 [Clostridium leptum DSM 753]
 gi|156867536|gb|EDO60908.1| hypothetical protein CLOLEP_02520 [Clostridium leptum DSM 753]
          Length = 93

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK ++ IA +TL NKS  S++++ ++ A+ AI  G  ++ TEA R A   I +
Sbjct: 8  MPNIKSAKKRVKVIATKTLRNKSYNSALKTAVKKADLAIEAGAADK-TEAVRAAIKKIDQ 66

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KGI H N A+RK S L+++L
Sbjct: 67 ATAKGILHKNTAARKKSALARKL 89


>gi|62257754|gb|AAX77736.1| unknown protein [synthetic construct]
          Length = 125

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 51/90 (56%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN   AKK I +  R    N +RRS +R+F++    AI  G +E A E   K   ++ K
Sbjct: 27  LANSKQAKKRIIQAERNRQHNVARRSMMRTFLKKTAYAIEKGDVEAAKENFAKVVPILDK 86

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             SKG+ H N A+R  SRLS ++K + T+A
Sbjct: 87  YASKGLIHKNKAARHKSRLSAKIKALATAA 116


>gi|121998622|ref|YP_001003409.1| ribosomal protein S20 [Halorhodospira halophila SL1]
 gi|166223941|sp|A1WY45|RS20_HALHL RecName: Full=30S ribosomal protein S20
 gi|121590027|gb|ABM62607.1| SSU ribosomal protein S20P [Halorhodospira halophila SL1]
          Length = 88

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+   R L NKSRRS +R+ M+   +A+  G  ++A +A R A  V+ +
Sbjct: 1  MANIASAKKRARQAEERRLRNKSRRSEMRTSMKKVLKAVKTGDHDQAQQAYRGAVRVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + ++GI H N A+R  SRL+ +++ +
Sbjct: 61 SANRGIIHKNKAARHKSRLNAKVRSL 86


>gi|206895797|ref|YP_002247102.1| ribosomal protein S20 [Coprothermobacter proteolyticus DSM 5265]
 gi|226736475|sp|B5Y8K5|RS20_COPPD RecName: Full=30S ribosomal protein S20
 gi|206738414|gb|ACI17492.1| ribosomal protein S20 [Coprothermobacter proteolyticus DSM 5265]
          Length = 88

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA++ IR   + T  N+  R++++++++ A +AI  G  E A  A  KA+SVI K
Sbjct: 1  MANTISAERRIRLTKKETAYNRYWRTTMKTYVKRAKKAIESGDREAAEAAVLKAQSVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
             KG+ H N A+R+ SRL K
Sbjct: 61 VAVKGVIHKNEAARRKSRLMK 81


>gi|256822885|ref|YP_003146848.1| 30S ribosomal protein S20 [Kangiella koreensis DSM 16069]
 gi|256796424|gb|ACV27080.1| ribosomal protein S20 [Kangiella koreensis DSM 16069]
          Length = 86

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+   R   N SRRS +RS+++    AI  G   +A  A  +A  VI K
Sbjct: 1  MANIKSAKKRARQAEARRQHNASRRSMLRSYIKKVVYAIDAGNKTDAQAAFERAIPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+R  SRL+ R++ +
Sbjct: 61 AANKGIIHKNKAARHKSRLTARIQAL 86


>gi|320353523|ref|YP_004194862.1| 30S ribosomal protein S20P [Desulfobulbus propionicus DSM 2032]
 gi|320122025|gb|ADW17571.1| SSU ribosomal protein S20P [Desulfobulbus propionicus DSM 2032]
          Length = 90

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+   R L N+  +S++++ +R   EAI  G  E+A  A + A  VI K
Sbjct: 1  MANHKSAEKRDRQAKMRRLRNRMNKSAMKTAVRQVEEAIAAGSEEQAKAALQAAIPVIYK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG  H   ASRKVSRL+KR+
Sbjct: 61 TSTKGSIHKKNASRKVSRLTKRV 83


>gi|218779048|ref|YP_002430366.1| ribosomal protein S20 [Desulfatibacillum alkenivorans AK-01]
 gi|226736481|sp|B8F9F2|RS20_DESAA RecName: Full=30S ribosomal protein S20
 gi|218760432|gb|ACL02898.1| ribosomal protein S20 [Desulfatibacillum alkenivorans AK-01]
          Length = 88

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 54/86 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++   + + N+S ++ +R+ ++  N+A+    ++EA     + +S+I K
Sbjct: 1  MANHKSALKRAKQNTIKQMRNRSYKTRLRNMVKKVNQAVEAQSVDEAKTILVETQSIIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N ASRK+SRL+K+++ +
Sbjct: 61 CASKGVIHKNTASRKISRLAKKVEAL 86


>gi|197117151|ref|YP_002137578.1| 30S ribosomal protein S20 [Geobacter bemidjiensis Bem]
 gi|253699414|ref|YP_003020603.1| 30S ribosomal protein S20 [Geobacter sp. M21]
 gi|226736500|sp|B5EE44|RS20_GEOBB RecName: Full=30S ribosomal protein S20
 gi|259494864|sp|C6E105|RS20_GEOSM RecName: Full=30S ribosomal protein S20
 gi|197086511|gb|ACH37782.1| ribosomal protein S20 [Geobacter bemidjiensis Bem]
 gi|251774264|gb|ACT16845.1| ribosomal protein S20 [Geobacter sp. M21]
          Length = 87

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 49/81 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I++ A+RT  NK  RS++R+F++   EA+     E A  A   A  VI  
Sbjct: 1  MANHKSAMKRIKQTAKRTERNKHERSTLRTFIKRVREAVATKDQEAAKAALAVAIPVIDG 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KGI H + ASR VSRL+K
Sbjct: 61 AATKGIIHSSNASRNVSRLTK 81


>gi|121534792|ref|ZP_01666612.1| ribosomal protein S20 [Thermosinus carboxydivorans Nor1]
 gi|121306587|gb|EAX47509.1| ribosomal protein S20 [Thermosinus carboxydivorans Nor1]
          Length = 88

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N   ++++R+  R   EA+  G++EEA     KA S+I K
Sbjct: 1  MPNIKSSIRSVKTDAERRARNFPVKTAIRTISRKVAEAVQAGQVEEAKTLLTKASSIIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAA+RK SRL++++  +
Sbjct: 61 AAAKGVIHKNAAARKKSRLAQKVNAL 86


>gi|94495383|ref|ZP_01301963.1| ribosomal protein S20 [Sphingomonas sp. SKA58]
 gi|94424771|gb|EAT09792.1| ribosomal protein S20 [Sphingomonas sp. SKA58]
          Length = 87

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+  RR  IN +R S +R+ ++    AI  G  + AT A +  +  + +
Sbjct: 1  MANTPQAKKRIRRNERRAAINGARISRIRTLVKKVEAAIVAGDKDAATTALQTVQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+RK  RL+K +  I
Sbjct: 61 GVARGVLHKNTAARKFGRLTKAVSAI 86


>gi|222055267|ref|YP_002537629.1| ribosomal protein S20 [Geobacter sp. FRC-32]
 gi|254813101|sp|B9M9F6|RS20_GEOSF RecName: Full=30S ribosomal protein S20
 gi|221564556|gb|ACM20528.1| ribosomal protein S20 [Geobacter sp. FRC-32]
          Length = 87

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I++  +RT  N+  RS++R+F++   EA+       A EA   A  VI  
Sbjct: 1  MANHKSALKRIKQTEKRTERNRHVRSTLRTFIKRVREAVAAKDANLAKEALAAAIPVIDG 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H + ASR VSRL+K
Sbjct: 61 AASKGVIHSSNASRSVSRLTK 81


>gi|169832207|ref|YP_001718189.1| 30S ribosomal protein S20 [Candidatus Desulforudis audaxviator
          MP104C]
 gi|226736482|sp|B1I6E6|RS20_DESAP RecName: Full=30S ribosomal protein S20
 gi|169639051|gb|ACA60557.1| ribosomal protein S20 [Candidatus Desulforudis audaxviator
          MP104C]
          Length = 88

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK I  I +RT  NKS +S++++ +R   EA+     E+A E  +KA   I K
Sbjct: 1  MAHSRSAKKRIETIRKRTERNKSAKSALKTAIRRFEEAVQGDDKEQAREKLQKALVSIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            SKGI H N A+R+ SRL+K+ 
Sbjct: 61 GVSKGILHKNTAARRKSRLTKKF 83


>gi|157374330|ref|YP_001472930.1| 30S ribosomal protein S20 [Shewanella sediminis HAW-EB3]
 gi|189044885|sp|A8FSH9|RS20_SHESH RecName: Full=30S ribosomal protein S20
 gi|157316704|gb|ABV35802.1| ribosomal protein S20 [Shewanella sediminis HAW-EB3]
          Length = 88

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +RS+++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRSYVKKVIAAINAGDHKAATEAFNAAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ SRL+ ++K +
Sbjct: 61 MATKGLIHKNKAARQKSRLNTKIKAL 86


>gi|302039503|ref|YP_003799825.1| 30S ribosomal protein S20 [Candidatus Nitrospira defluvii]
 gi|300607567|emb|CBK43900.1| 30S ribosomal protein S20 [Candidatus Nitrospira defluvii]
          Length = 91

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 48/79 (60%)

Query: 12 RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNA 71
          R+  +R L N++  SSVRS +R   +AI   K +EA    R+A S + KA +KG+   N 
Sbjct: 13 RQSEKRRLRNRATISSVRSILRKVQDAIAAKKPDEAKATLREATSALGKAVTKGVLKPNT 72

Query: 72 ASRKVSRLSKRLKGILTSA 90
          ASR+VSRL+ R+  +  SA
Sbjct: 73 ASRRVSRLTVRVNALTASA 91


>gi|294139770|ref|YP_003555748.1| 30S ribosomal protein S20 [Shewanella violacea DSS12]
 gi|293326239|dbj|BAJ00970.1| ribosomal protein S20 [Shewanella violacea DSS12]
          Length = 88

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +RS+++    AI  G    ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRSYVKKVITAIKAGDHTAATEAFNAAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGI H N A+R+ SRL+ ++K +
Sbjct: 61 MATKGIIHKNKAARQKSRLNTKIKAL 86


>gi|51245470|ref|YP_065354.1| 30S ribosomal protein S20 [Desulfotalea psychrophila LSv54]
 gi|59798685|sp|Q6AMS8|RS20_DESPS RecName: Full=30S ribosomal protein S20
 gi|50876507|emb|CAG36347.1| probable 30S ribosomal protein S20 [Desulfotalea psychrophila
          LSv54]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+     L NKS R+++++ +R  +EA+  G   +  EA R A S I K
Sbjct: 1  MANHKSAEKRNRQNQVARLRNKSTRTAMKNSVRKLDEALEAGVEADTAEALRGAISRIAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            SKG+ H   ASRK+SRL+KR+  ++
Sbjct: 61 TASKGVIHKKTASRKISRLTKRVNALV 87


>gi|331084372|ref|ZP_08333476.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330401636|gb|EGG81217.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 87

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 1  MANKDSAKKMI---RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV 57
          MAN  SAKK +   RK A R   NKS +S+V++ +R    AI     E A+ A   A S 
Sbjct: 1  MANIKSAKKRVLVNRKKAER---NKSIKSAVKTSIRKVEAAIEAKDKEAASAALLNAIST 57

Query: 58 IQKAKSKGIFHGNAASRKVSRLSK 81
          I KA SKG++H N A+RKVSRLSK
Sbjct: 58 IDKAASKGVYHKNTAARKVSRLSK 81


>gi|218679661|ref|ZP_03527558.1| ribosomal protein S20 [Rhizobium etli CIAT 894]
          Length = 59

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEA 50
          MAN  SAKK  RKIARRT +NK+RRS VR+F+R   EAI  G   +A EA
Sbjct: 1  MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDAAKAKEA 50


>gi|163750655|ref|ZP_02157892.1| ribosomal protein S20 [Shewanella benthica KT99]
 gi|161329650|gb|EDQ00641.1| ribosomal protein S20 [Shewanella benthica KT99]
          Length = 88

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +RS+++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRSYVKKVIAAIKAGDHKAATEAFNVAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGI H N A+R+ SRL+ ++K +
Sbjct: 61 MATKGIIHKNKAARQKSRLNTKIKAL 86


>gi|292490240|ref|YP_003525679.1| ribosomal protein S20 [Nitrosococcus halophilus Nc4]
 gi|291578835|gb|ADE13292.1| ribosomal protein S20 [Nitrosococcus halophilus Nc4]
          Length = 87

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R L N S+RS +R++M+   +AI  G  E+AT A   A  V+ +
Sbjct: 1  MANSLQARKRARQAEKRRLHNASQRSMMRTYMKKVIKAIASGDKEQATVAYGVAVPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  SRLS R++ +
Sbjct: 61 LARKGLIHPNKAARHKSRLSARIRSM 86


>gi|251796209|ref|YP_003010940.1| ribosomal protein S20 [Paenibacillus sp. JDR-2]
 gi|247543835|gb|ACT00854.1| ribosomal protein S20 [Paenibacillus sp. JDR-2]
          Length = 90

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++ A++AI    +E A  A   A   + K
Sbjct: 1  MPNIKSAIKRVKTSEKRRALNASQKSALRTAVKSADQAIAGTDVEVAKAALVAATKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAASRK SRL+K+L  +
Sbjct: 61 AVTKGLIHKNAASRKKSRLAKKLNAL 86


>gi|160880450|ref|YP_001559418.1| ribosomal protein S20 [Clostridium phytofermentans ISDg]
 gi|189044857|sp|A9KKU7|RS20_CLOPH RecName: Full=30S ribosomal protein S20
 gi|160429116|gb|ABX42679.1| ribosomal protein S20 [Clostridium phytofermentans ISDg]
          Length = 87

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +S V++ ++    A+     + AT++ + A   I K
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKVIKSKVKTLVKKVEVAVAASDKDLATKSLKDAVVAIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H   A+RKV RL+K +  I
Sbjct: 61 AASKGVYHKKNAARKVGRLAKAVNSI 86


>gi|296283100|ref|ZP_06861098.1| 30S ribosomal protein S20 [Citromicrobium bathyomarinum JL354]
          Length = 86

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K IR+  RR  IN +R S +R+F++    AI  G  E A  A R A+  + +
Sbjct: 1  MANTPQARKRIRRNERRAEINGARMSRIRTFLKKVESAIEGGDKETAQTALRAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N ASRK+SRLSKR+  +
Sbjct: 61 GVARGVLHKNTASRKMSRLSKRVAAL 86


>gi|15599759|ref|NP_253253.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa PAO1]
 gi|116052706|ref|YP_793022.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893658|ref|YP_002442527.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa LESB58]
 gi|254238689|ref|ZP_04932012.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa C3719]
 gi|254244540|ref|ZP_04937862.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa 2192]
 gi|296391377|ref|ZP_06880852.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa PAb1]
 gi|313107208|ref|ZP_07793407.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa 39016]
 gi|17865595|sp|Q9HVM1|RS20_PSEAE RecName: Full=30S ribosomal protein S20
 gi|122257284|sp|Q02GB4|RS20_PSEAB RecName: Full=30S ribosomal protein S20
 gi|226695404|sp|B7V0A6|RS20_PSEA8 RecName: Full=30S ribosomal protein S20
 gi|9950809|gb|AAG07951.1|AE004870_2 30S ribosomal protein S20 [Pseudomonas aeruginosa PAO1]
 gi|115587927|gb|ABJ13942.1| ribosomal protein S20 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170620|gb|EAZ56131.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa C3719]
 gi|126197918|gb|EAZ61981.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa 2192]
 gi|218773886|emb|CAW29700.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa LESB58]
 gi|310879909|gb|EFQ38503.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa 39016]
          Length = 91

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI    +E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDLEKAQAAFTAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRLS  +K + T+A
Sbjct: 61 MADKGIIHKNKAARHKSRLSGHIKALSTAA 90


>gi|83309734|ref|YP_419998.1| 30S ribosomal protein S20 [Magnetospirillum magneticum AMB-1]
 gi|115305686|sp|Q2W9N6|RS20_MAGMM RecName: Full=30S ribosomal protein S20
 gi|82944575|dbj|BAE49439.1| Ribosomal protein S20 [Magnetospirillum magneticum AMB-1]
          Length = 90

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 51/84 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK IR+  RRT +N++R S +R++++    AI  G    A  A ++A+  + K
Sbjct: 1  MAHHKSAKKRIRQTERRTEVNRARVSRIRTYVKKVELAIAGGDSAAAQAALQEAQPELMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
              GI H N ASRKVSRL  R+K
Sbjct: 61 GAQAGILHKNTASRKVSRLVARVK 84


>gi|49073286|gb|AAT49307.1| PA4563 [synthetic construct]
          Length = 92

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI    +E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDLEKAQAAFTAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRLS  +K + T+A
Sbjct: 61 MADKGIIHKNKAARHKSRLSGHIKALSTAA 90


>gi|303229641|ref|ZP_07316429.1| ribosomal protein S20 [Veillonella atypica ACS-134-V-Col7a]
 gi|303232032|ref|ZP_07318735.1| ribosomal protein S20 [Veillonella atypica ACS-049-V-Sch6]
 gi|302513138|gb|EFL55177.1| ribosomal protein S20 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515766|gb|EFL57720.1| ribosomal protein S20 [Veillonella atypica ACS-134-V-Col7a]
          Length = 86

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N + +S +R+  R   EA+  G +EEA +A  +A SVI K
Sbjct: 1  MPNIKSSIRSVKTDAERRAKNAAVKSQIRTAARKTVEAVQAGAVEEAKQALVQATSVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK S L+ ++  +
Sbjct: 61 AASKGVLHKNTAARKKSNLAAKVNAL 86


>gi|229827586|ref|ZP_04453655.1| hypothetical protein GCWU000182_02975 [Abiotrophia defectiva ATCC
          49176]
 gi|229788224|gb|EEP24338.1| hypothetical protein GCWU000182_02975 [Abiotrophia defectiva ATCC
          49176]
          Length = 87

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+  A++TL NK   S V++ ++    A+     E A  A   A + I K
Sbjct: 1  MANIKSAKKRIKVAAKKTLRNKMITSRVKTLVKKVVSAVALSDNEAAKVALAPAVAAIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KG++H   ASRK+SRL+K
Sbjct: 61 AANKGVYHRKTASRKISRLTK 81


>gi|300087141|ref|YP_003757663.1| 30S ribosomal protein S20 [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
 gi|299526874|gb|ADJ25342.1| ribosomal protein S20 [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
          Length = 84

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (61%), Gaps = 4/84 (4%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-ACRKAESVIQ 59
          MAN  SAKK I   A+R   NKS RS++++ +R A +AI  G   E TE A   ++S + 
Sbjct: 1  MANTKSAKKDILTSAKRAERNKSARSALKTTIRKAEKAIASG---EGTENALIASQSALD 57

Query: 60 KAKSKGIFHGNAASRKVSRLSKRL 83
           A  KGI H N A+RK SRL+K+L
Sbjct: 58 IAAKKGIIHANTAARKKSRLAKKL 81


>gi|323449104|gb|EGB04995.1| hypothetical protein AURANDRAFT_31536 [Aureococcus
          anophagefferens]
          Length = 102

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A K I+   R  + N + RS VR+  R   EAI  G  + A E  R+  S I +
Sbjct: 1  MANNAGALKRIKTNERNRVRNAAWRSKVRTLTRKTKEAIEAGDADLAKECARQTTSAIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A  +GI+H N A+R  SRLSK +  ++
Sbjct: 61 ATRRGIYHKNWAARNKSRLSKNVIALI 87


>gi|84514655|ref|ZP_01002019.1| ribosomal protein S20 [Loktanella vestfoldensis SKA53]
 gi|84511706|gb|EAQ08159.1| ribosomal protein S20 [Loktanella vestfoldensis SKA53]
          Length = 65

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          RRS +R+F+R   EAI  G    A  A R A+  + +  +KG+ H N A+RK+SRLS R+
Sbjct: 2  RRSRIRTFLRKVEEAIATGDQTVAIAALRAAQPELMRGVTKGVVHKNTAARKMSRLSARV 61

Query: 84 KGI 86
          K I
Sbjct: 62 KAI 64


>gi|78223500|ref|YP_385247.1| 30S ribosomal protein S20 [Geobacter metallireducens GS-15]
 gi|115305684|sp|Q39TA2|RS20_GEOMG RecName: Full=30S ribosomal protein S20
 gi|78194755|gb|ABB32522.1| SSU ribosomal protein S20P [Geobacter metallireducens GS-15]
          Length = 87

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 52/81 (64%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SA K I++  R+   NKS RS +R+F+++  EA+      +A EA + A  VI K
Sbjct: 1  MAHHKSALKRIKQNKRKQFRNKSIRSGLRTFIKNVREAVEAKDAAKAKEALQAAIPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KGI H NAASR VSRL+K
Sbjct: 61 AATKGIIHANAASRNVSRLTK 81


>gi|56963416|ref|YP_175147.1| 30S ribosomal protein S20 [Bacillus clausii KSM-K16]
 gi|59798606|sp|Q5WHG9|RS20_BACSK RecName: Full=30S ribosomal protein S20
 gi|56909659|dbj|BAD64186.1| 30S ribosomal protein S20 [Bacillus clausii KSM-K16]
          Length = 88

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R   N +++S++R+ ++H   A   G +E+A  A  +A   + K
Sbjct: 1  MPNIKSAIKRVKTNEKRRAQNAAQKSALRTAVKHFETAAANGDVEKAQAAFVEASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAASR+ SRL+K+L G+
Sbjct: 61 AATKGLIHKNAASRQKSRLAKKLNGL 86


>gi|260590115|ref|ZP_05856028.1| ribosomal protein S20 [Blautia hansenii DSM 20583]
 gi|260539627|gb|EEX20196.1| ribosomal protein S20 [Blautia hansenii DSM 20583]
          Length = 90

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 1  MANKDSAKKMI---RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV 57
          +AN  SAKK +   RK A R   NKS +S+V++ +R    AI     E A+ A   A S 
Sbjct: 4  LANIKSAKKRVLVNRKKAER---NKSIKSAVKTSIRKVEAAIEAKDKEAASAALLNAIST 60

Query: 58 IQKAKSKGIFHGNAASRKVSRLSK 81
          I KA SKG++H N A+RKVSRLSK
Sbjct: 61 IDKAASKGVYHKNTAARKVSRLSK 84


>gi|332799041|ref|YP_004460540.1| 30S ribosomal protein S20 [Tepidanaerobacter sp. Re1]
 gi|332696776|gb|AEE91233.1| 30S ribosomal protein S20 [Tepidanaerobacter sp. Re1]
          Length = 90

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +R+  +RTL N   +S +R  ++   EA+     +    + ++A  +I K
Sbjct: 1  MANIASAKKRVRQANKRTLQNNKVKSQMRYSIKKFLEAVDTADFDNIQTSFKEAVKIIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H NAA+RK S L K+L
Sbjct: 61 AASKGVIHKNAAARKKSNLYKKL 83


>gi|257066674|ref|YP_003152930.1| 30S ribosomal protein S20 [Anaerococcus prevotii DSM 20548]
 gi|256798554|gb|ACV29209.1| ribosomal protein S20 [Anaerococcus prevotii DSM 20548]
          Length = 88

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK I    R TL NKSR+S +++ ++  + AI    +E+AT   +KA+  +++
Sbjct: 1  MANIKSSKKRIDVARRNTLRNKSRKSEIKTLIKKFDAAIEEKDVEKATAIFKKADKRLKQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A++K + H N  +R  SRL+K L  +
Sbjct: 61 AEAKNVMHKNKVARTTSRLAKALNQV 86


>gi|50084567|ref|YP_046077.1| 30S ribosomal protein S20 [Acinetobacter sp. ADP1]
 gi|59798699|sp|Q6FCF6|RS20_ACIAD RecName: Full=30S ribosomal protein S20
 gi|49530543|emb|CAG68255.1| 30S ribosomal protein S20 [Acinetobacter sp. ADP1]
          Length = 89

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI  G    ATEA +KA  VI +
Sbjct: 1  MANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTVNAIAAGDYTVATEAYKKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
             KGI H N A+R  SRL+ ++K + ++
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKALASN 89


>gi|304403912|ref|ZP_07385574.1| ribosomal protein S20 [Paenibacillus curdlanolyticus YK9]
 gi|304346890|gb|EFM12722.1| ribosomal protein S20 [Paenibacillus curdlanolyticus YK9]
          Length = 90

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++ A++AI    +E A  A   A   + K
Sbjct: 1  MPNIKSAIKRVKTSEKRRALNASQKSALRTAVKSADQAIAGTDVEVAKVALVAASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAA+RK SRL+K+L  +
Sbjct: 61 AATKGLIHKNAAARKKSRLAKKLNAL 86


>gi|307294071|ref|ZP_07573915.1| ribosomal protein S20 [Sphingobium chlorophenolicum L-1]
 gi|306880222|gb|EFN11439.1| ribosomal protein S20 [Sphingobium chlorophenolicum L-1]
          Length = 87

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+ ARR  IN +R S +R+ ++    A+  G    A  A +  +  + +
Sbjct: 1  MANTPQAKKRIRRNARRAEINGARISRIRTLVKKVEAALAAGDKAVAATALQAVQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+RK  RL+KR+  +
Sbjct: 61 GVARGVLHKNTAARKFGRLTKRVSAL 86


>gi|261405578|ref|YP_003241819.1| 30S ribosomal protein S20 [Paenibacillus sp. Y412MC10]
 gi|329924035|ref|ZP_08279298.1| ribosomal protein S20 [Paenibacillus sp. HGF5]
 gi|261282041|gb|ACX64012.1| ribosomal protein S20 [Paenibacillus sp. Y412MC10]
 gi|328940874|gb|EGG37182.1| ribosomal protein S20 [Paenibacillus sp. HGF5]
          Length = 90

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 56/90 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++ A+ A+   +IE A  A + A   + K
Sbjct: 1  MPNIKSAIKRVKTNDKRHALNISQKSALRTAVKTADVALNGTEIEAAKVAFQAASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H NAA+RK SRL+KRL  + + A
Sbjct: 61 AVTKGLIHKNAAARKKSRLAKRLNALTSQA 90


>gi|331090924|ref|ZP_08339766.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405146|gb|EGG84682.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 87

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     R   NK+ +S V++ ++    A+       A EA R A   I K
Sbjct: 1  MANIKSAKKRILVNETRAARNKAIKSKVKTCVKKVEAAVAANDKTVAAEALRVAIVEINK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N A+RKVSRL+K + GI
Sbjct: 61 AASKGVYHKNTAARKVSRLTKAVNGI 86


>gi|269797838|ref|YP_003311738.1| ribosomal protein S20 [Veillonella parvula DSM 2008]
 gi|282848821|ref|ZP_06258214.1| ribosomal protein S20 [Veillonella parvula ATCC 17745]
 gi|269094467|gb|ACZ24458.1| ribosomal protein S20 [Veillonella parvula DSM 2008]
 gi|282581475|gb|EFB86865.1| ribosomal protein S20 [Veillonella parvula ATCC 17745]
          Length = 86

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N + +S +R+  R   EA+  G +EEA +A   A SVI K
Sbjct: 1  MPNIKSSIRSVKTDAERRAKNAAVKSQIRTAARKTVEAVQAGAVEEAKQALVHATSVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK S L+ ++  +
Sbjct: 61 AASKGVLHKNTAARKKSNLAAKVNAL 86


>gi|86159147|ref|YP_465932.1| 30S ribosomal protein S20 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|115305667|sp|Q2ILG4|RS20_ANADE RecName: Full=30S ribosomal protein S20
 gi|85775658|gb|ABC82495.1| SSU ribosomal protein S20P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 92

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +R   N   R+ V+S ++   EAI  G       A + AE  I K
Sbjct: 1  MANTASAEKRNRQAQKRRARNVQVRTGVKSAVKKLREAIAKGDPATTQAALKSAEKTIGK 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A SKG+ H NAASRK+SRL
Sbjct: 61 AASKGVLHRNAASRKISRL 79


>gi|148557779|ref|YP_001265361.1| 30S ribosomal protein S20 [Sphingomonas wittichii RW1]
 gi|166223991|sp|A5VG07|RS20_SPHWW RecName: Full=30S ribosomal protein S20
 gi|148502969|gb|ABQ71223.1| SSU ribosomal protein S20P [Sphingomonas wittichii RW1]
          Length = 87

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+  RR  IN +R S +R+F++    A+  G    AT A   A+  + +
Sbjct: 1  MANTPQAKKRIRRNDRRAEINGARVSRIRTFVKKVEAALAAGDKTAATAALAAAQPELFR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            SKG+ H N ASRK SRL+KR+
Sbjct: 61 GVSKGVVHKNTASRKFSRLTKRI 83


>gi|109948017|ref|YP_665245.1| 30S ribosomal protein S20 [Helicobacter acinonychis str. Sheeba]
 gi|122973222|sp|Q17VT0|RS20_HELAH RecName: Full=30S ribosomal protein S20
 gi|109715238|emb|CAK00246.1| 30S ribosomal protein S20 [Helicobacter acinonychis str. Sheeba]
 gi|317010357|gb|ADU84104.1| 30S ribosomal protein S20 [Helicobacter pylori SouthAfrica7]
          Length = 89

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++ ++   EA+    +E+A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKIKNIIKAVREAVAVNDVEKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|167766648|ref|ZP_02438701.1| hypothetical protein CLOSS21_01154 [Clostridium sp. SS2/1]
 gi|317499481|ref|ZP_07957747.1| ribosomal protein S20 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167711771|gb|EDS22350.1| hypothetical protein CLOSS21_01154 [Clostridium sp. SS2/1]
 gi|316893255|gb|EFV15471.1| ribosomal protein S20 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 92

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I+ I  +T  NK+ ++ V+++++    AI       A+EA     S I K
Sbjct: 6  LANIKSAKKRIKVINTKTERNKAIKTKVKTYIKKVEAAIAANDKAAASEALTACISEISK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGIFH N ASRK++RLSK +  I
Sbjct: 66 ATSKGIFHKNTASRKIARLSKAVNAI 91


>gi|161546619|ref|NP_861309.2| 30S ribosomal protein S20 [Helicobacter hepaticus ATCC 51449]
 gi|59798855|sp|Q7VF99|RS20_HELHP RecName: Full=30S ribosomal protein S20
          Length = 90

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+   RT  N+  ++ +++ +R   EA+    + +A EA + A   + K
Sbjct: 1  MANHKSAQKRIRQTKTRTERNRYYKTRIKNIVRDLREAVLNKDVAKAQEALKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKGI   N A+RKVSRL+  +K I  SA
Sbjct: 61 YVSKGILKKNTAARKVSRLNASVKKIAQSA 90


>gi|32263330|gb|AAP78375.1| ribosomal protein S20 [Helicobacter hepaticus ATCC 51449]
          Length = 105

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SA+K IR+   RT  N+  ++ +++ +R   EA+    + +A EA + A   + K
Sbjct: 16  MANHKSAQKRIRQTKTRTERNRYYKTRIKNIVRDLREAVLNKDVAKAQEALKIANKELHK 75

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             SKGI   N A+RKVSRL+  +K I  SA
Sbjct: 76  YVSKGILKKNTAARKVSRLNASVKKIAQSA 105


>gi|290968903|ref|ZP_06560440.1| ribosomal protein S20 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781199|gb|EFD93790.1| ribosomal protein S20 [Megasphaera genomosp. type_1 str. 28L]
          Length = 88

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 43/78 (55%)

Query: 9  KMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFH 68
          K + K A R   N   +SSV + +R   EAIT G IE    A  KA SVI  A  KG+ H
Sbjct: 9  KTMEKDAARHAANSQVKSSVHTAIRRTEEAITAGDIEAVKVAFNKAGSVIDSAAQKGVLH 68

Query: 69 GNAASRKVSRLSKRLKGI 86
           N A+RK SRL+ ++  +
Sbjct: 69 KNTAARKKSRLAAKVNAM 86


>gi|114320010|ref|YP_741693.1| SSU ribosomal protein S20P [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312142|sp|Q0AAD4|RS20_ALHEH RecName: Full=30S ribosomal protein S20
 gi|114226404|gb|ABI56203.1| SSU ribosomal protein S20P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 88

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  +R   N+S+RS +R++++    AI  G   +A EA + A  VI +
Sbjct: 1  MANIPSAKKRARQAEKRRKHNQSQRSMMRTYIKRVVNAIKAGDKAQAEEAYKVAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+R  SRL++ L+ +
Sbjct: 61 MATRGLIHKNKAARHKSRLNQHLRNL 86


>gi|224437762|ref|ZP_03658709.1| 30S ribosomal protein S20 [Helicobacter cinaedi CCUG 18818]
 gi|313144208|ref|ZP_07806401.1| 30S ribosomal protein S20 [Helicobacter cinaedi CCUG 18818]
 gi|313129239|gb|EFR46856.1| 30S ribosomal protein S20 [Helicobacter cinaedi CCUG 18818]
          Length = 90

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+   RT  N+  ++ +++ +R   EA+    + +A EA + A   + K
Sbjct: 1  MANHKSAEKRIRQTKTRTERNRYYKTRIKNIVRDLREAVASKDVAKAQEALKIANRELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKGI   N ASRKVSRL+  +K +  SA
Sbjct: 61 YVSKGILKKNTASRKVSRLNASVKKLAQSA 90


>gi|197123219|ref|YP_002135170.1| 30S ribosomal protein S20 [Anaeromyxobacter sp. K]
 gi|220918008|ref|YP_002493312.1| ribosomal protein S20 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226735292|sp|B4UIK8|RS20_ANASK RecName: Full=30S ribosomal protein S20
 gi|254813039|sp|B8JEV0|RS20_ANAD2 RecName: Full=30S ribosomal protein S20
 gi|196173068|gb|ACG74041.1| ribosomal protein S20 [Anaeromyxobacter sp. K]
 gi|219955862|gb|ACL66246.1| ribosomal protein S20 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 91

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +R   N   R+ V+S ++   EAI  G       A + AE  I K
Sbjct: 1  MANTASAEKRNRQAQKRRARNVQVRTGVKSAVKKLREAIAKGDPAATQVALKSAEKTIGK 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A SKG+ H NAASRK+SRL
Sbjct: 61 AASKGVLHKNAASRKISRL 79


>gi|313893693|ref|ZP_07827260.1| ribosomal protein S20 [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441707|gb|EFR60132.1| ribosomal protein S20 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 86

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N + +S +R+  R   EA+  G +EEA +A   A SVI K
Sbjct: 1  MPNIKSSIRSVKTDAERRAKNAAVKSQIRTASRKTVEAVQAGAVEEAKQALVHATSVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK S L+ ++  +
Sbjct: 61 AASKGVLHKNTAARKKSNLAAKVNAL 86


>gi|317122997|ref|YP_004103000.1| 30S ribosomal protein S20P [Thermaerobacter marianensis DSM
          12885]
 gi|315592977|gb|ADU52273.1| SSU ribosomal protein S20P [Thermaerobacter marianensis DSM
          12885]
          Length = 90

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA+K +R+  R  L NK  +S +++ +R   EA+  G       A R+A S I +
Sbjct: 1  MPNTRSARKRVRQSERNRLRNKMYKSRIKTAIRRLEEALAGGDDGAIQAALRRAMSAIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A  +G  H NAA+RK SRL++RLK
Sbjct: 61 AALRGAIHRNAAARKKSRLAQRLK 84


>gi|127512029|ref|YP_001093226.1| 30S ribosomal protein S20 [Shewanella loihica PV-4]
 gi|166223986|sp|A3QBW9|RS20_SHELP RecName: Full=30S ribosomal protein S20
 gi|126637324|gb|ABO22967.1| SSU ribosomal protein S20P [Shewanella loihica PV-4]
          Length = 88

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +RS+++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRSYVKKVIAAINTGDHKAATEAFNAAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKARLNAKIKAL 86


>gi|291519622|emb|CBK74843.1| SSU ribosomal protein S20P [Butyrivibrio fibrisolvens 16/4]
          Length = 87

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 47/81 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +   A RT  NK+ RS V+++++    A+       A    + A  VI+ 
Sbjct: 1  MANIKSAKKRVLVTAVRTERNKAIRSEVKTYVKRVEAAVEAKDKALAESELKAAVKVIEM 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG++H N  SRKVSRL+K
Sbjct: 61 AGSKGVYHDNTVSRKVSRLAK 81


>gi|291276375|ref|YP_003516147.1| 30S ribosomal protein S20 [Helicobacter mustelae 12198]
 gi|290963569|emb|CBG39401.1| 30S ribosomal protein S20 [Helicobacter mustelae 12198]
          Length = 90

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  R+ +++ ++    ++   ++E+A EA + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRYYRTRIKNIIKAVRTSVAANEVEKAQEALKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKGI   N ASR+VSRL+  +K I  SA
Sbjct: 61 FVSKGIIKKNTASRRVSRLNAAVKKIALSA 90


>gi|126641662|ref|YP_001084646.1| 30S ribosomal protein S20 [Acinetobacter baumannii ATCC 17978]
 gi|169633473|ref|YP_001707209.1| 30S ribosomal protein S20 [Acinetobacter baumannii SDF]
 gi|169796108|ref|YP_001713901.1| 30S ribosomal protein S20 [Acinetobacter baumannii AYE]
 gi|184157964|ref|YP_001846303.1| 30S ribosomal protein S20 [Acinetobacter baumannii ACICU]
 gi|213157159|ref|YP_002319204.1| ribosomal protein S20 [Acinetobacter baumannii AB0057]
 gi|215483563|ref|YP_002325782.1| ribosomal protein S20 [Acinetobacter baumannii AB307-0294]
 gi|239502157|ref|ZP_04661467.1| ribosomal protein S20 [Acinetobacter baumannii AB900]
 gi|260550137|ref|ZP_05824351.1| ribosomal protein S20 [Acinetobacter sp. RUH2624]
 gi|260555157|ref|ZP_05827378.1| ribosomal protein S20 [Acinetobacter baumannii ATCC 19606]
 gi|301345063|ref|ZP_07225804.1| 30S ribosomal protein S20 [Acinetobacter baumannii AB056]
 gi|301510454|ref|ZP_07235691.1| 30S ribosomal protein S20 [Acinetobacter baumannii AB058]
 gi|301595224|ref|ZP_07240232.1| 30S ribosomal protein S20 [Acinetobacter baumannii AB059]
 gi|332851760|ref|ZP_08433685.1| ribosomal protein S20 [Acinetobacter baumannii 6013150]
 gi|332865860|ref|ZP_08436644.1| ribosomal protein S20 [Acinetobacter baumannii 6013113]
 gi|332874423|ref|ZP_08442326.1| ribosomal protein S20 [Acinetobacter baumannii 6014059]
 gi|166200003|sp|A3M550|RS20_ACIBT RecName: Full=30S ribosomal protein S20
 gi|226735279|sp|B7H3I4|RS20_ACIB3 RecName: Full=30S ribosomal protein S20
 gi|226735280|sp|B7I5N9|RS20_ACIB5 RecName: Full=30S ribosomal protein S20
 gi|226735281|sp|B2HZH0|RS20_ACIBC RecName: Full=30S ribosomal protein S20
 gi|226735282|sp|B0VNU2|RS20_ACIBS RecName: Full=30S ribosomal protein S20
 gi|226735283|sp|B0VD42|RS20_ACIBY RecName: Full=30S ribosomal protein S20
 gi|126387546|gb|ABO12044.1| 30S ribosomal protein S20 [Acinetobacter baumannii ATCC 17978]
 gi|169149035|emb|CAM86912.1| 30S ribosomal protein S20 [Acinetobacter baumannii AYE]
 gi|169152265|emb|CAP01170.1| 30S ribosomal protein S20 [Acinetobacter baumannii]
 gi|183209558|gb|ACC56956.1| putative 30S ribosomal protein S20 [Acinetobacter baumannii
          ACICU]
 gi|213056319|gb|ACJ41221.1| ribosomal protein S20 [Acinetobacter baumannii AB0057]
 gi|213987392|gb|ACJ57691.1| ribosomal protein S20 [Acinetobacter baumannii AB307-0294]
 gi|260406892|gb|EEX00371.1| ribosomal protein S20 [Acinetobacter sp. RUH2624]
 gi|260411699|gb|EEX04996.1| ribosomal protein S20 [Acinetobacter baumannii ATCC 19606]
 gi|322508283|gb|ADX03737.1| rpsT [Acinetobacter baumannii 1656-2]
 gi|323517909|gb|ADX92290.1| 30S ribosomal protein S20 [Acinetobacter baumannii TCDC-AB0715]
 gi|332729767|gb|EGJ61102.1| ribosomal protein S20 [Acinetobacter baumannii 6013150]
 gi|332735072|gb|EGJ66157.1| ribosomal protein S20 [Acinetobacter baumannii 6013113]
 gi|332737267|gb|EGJ68191.1| ribosomal protein S20 [Acinetobacter baumannii 6014059]
          Length = 88

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI  G    ATEA +KA  VI +
Sbjct: 1  MANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTLSAIAGGDYAVATEAYKKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|320334606|ref|YP_004171317.1| 30S ribosomal protein S20 [Deinococcus maricopensis DSM 21211]
 gi|319755895|gb|ADV67652.1| 30S ribosomal protein S20 [Deinococcus maricopensis DSM 21211]
          Length = 92

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K  R+  +R L N+SR+S++++F + A +AI  G  E A     KAES+I KA    
Sbjct: 7  SAQKRHRQSLKRRLRNRSRKSTIKTFTKKAVQAIQEG-AENAVALQSKAESLIDKAAKGS 65

Query: 66 IFHGNAASRKVSRLSKRL 83
            H NAA+RK SRL+KR+
Sbjct: 66 TLHKNAAARKKSRLAKRI 83


>gi|304309973|ref|YP_003809571.1| 30S ribosomal protein S20 [gamma proteobacterium HdN1]
 gi|301795706|emb|CBL43905.1| 30S ribosomal protein S20 [gamma proteobacterium HdN1]
          Length = 88

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R   N   RS VR++++    AI  G    A EA ++A+ VI +
Sbjct: 1  MANTKQAKKRARQSEKRRRHNIGLRSVVRTYIKKVIAAIRAGDKPAAQEAFKEAQPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI H N A+R  SRL+ R+K +
Sbjct: 61 IASKGIIHKNKAARHKSRLNARIKAM 86


>gi|46199333|ref|YP_005000.1| 30S ribosomal protein S20 [Thermus thermophilus HB27]
 gi|50401374|sp|P62661|RS20_THET2 RecName: Full=30S ribosomal protein S20
 gi|10835604|pdb|1FJG|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With The Antibiotics Streptomycin,
          Spectinomycin, And Paromomycin
 gi|13096413|pdb|1HR0|T Chain T, Crystal Structure Of Initiation Factor If1 Bound To The
          30s Ribosomal Subunit
 gi|13399811|pdb|1HNW|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Tetracycline
 gi|13399833|pdb|1HNX|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Pactamycin
 gi|13399855|pdb|1HNZ|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Hygromycin B
 gi|14278029|pdb|1GIX|W Chain W, Crystal Structure Of The Ribosome At 5.5 A Resolution.
          This File, 1gix, Contains The 30s Ribosome Subunit,
          Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
          In The File 1giy
 gi|15826139|pdb|1JGO|W Chain W, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgo, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 gi|15826164|pdb|1JGP|W Chain W, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgp, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 gi|15826189|pdb|1JGQ|W Chain W, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgq, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 gi|20663905|pdb|1J5E|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit
 gi|28373718|pdb|1ML5|W Chain W, Structure Of The E. Coli Ribosomal Termination Complex
          With Release Factor 2
 gi|66361073|pdb|1YL4|W Chain W, Crystal Structure Of 70s Ribosome With Thrs Operator And
          Trnas. 30s Subunit. The Coordinates For The 50s Subunit
          Are In The Pdb Entry 1yl3
 gi|88192255|pdb|2B64|T Chain T, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor
          Rf1 From A Crystal Structure Of The Whole Ribosomal
          Complex. This File Contains The 30s Subunit, Trnas,
          Mrna And Release Factor Rf1 From A Crystal Structure Of
          The Whole Ribosomal Complex". The Entire Crystal
          Structure Contains One 70s Ribosome, Trnas, Mrna And
          Release Factor Rf1 And Is Described In Remark 400.
 gi|88192318|pdb|2B9M|T Chain T, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor
          Rf2 From A Crystal Structure Of The Whole Ribosomal
          Complex. This File Contains The 30s Ribosomal Subunit,
          Trnas, Mrna And Release Factor Rf2 From A Crystal
          Structure Of The Whole Ribosomal Complex". The Entire
          Crystal Structure Contains One 70s Ribosome, Trnas,
          Mrna And Release Factor Rf2 And Is Described In Remark
          400.
 gi|88192374|pdb|2B9O|T Chain T, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal
          Structure Of The Whole Ribosomal Complex With A Stop
          Codon In The A-Site. This File Contains The 30s
          Subunit, Trnas And Mrna From A Crystal Structure Of The
          Whole Ribosomal Complex With A Stop Codon In The A-Site
          And Is Described In Remark 400.
 gi|110591342|pdb|2F4V|T Chain T, 30s Ribosome + Designer Antibiotic
 gi|149242727|pdb|2OW8|UU Chain u, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
          Functional Interactions And Rearrangements. This File,
          2ow8, Contains The 30s Ribosome Subunit, Two Trna, And
          Mrna Molecules. 50s Ribosome Subunit Is In The File
          1vsa.
 gi|149243857|pdb|2UXC|T Chain T, Crystal Structure Of An Extended Trna Anticodon Stem
          Loop In Complex With Its Cognate Mrna Ucgu In The
          Context Of The Thermus Thermophilus 30s Subunit.
 gi|157836427|pdb|2UXB|T Chain T, Crystal Structure Of An Extended Trna Anticodon Stem
          Loop In Complex With Its Cognate Mrna Gggu In The
          Context Of The Thermus Thermophilus 30s Subunit.
 gi|158430919|pdb|2UXD|T Chain T, Crystal Structure Of An Extended Trna Anticodon Stem
          Loop In Complex With Its Cognate Mrna Cggg In The
          Context Of The Thermus Thermophilus 30s Subunit.
 gi|160285958|pdb|2QNH|UU Chain u, Interactions And Dynamics Of The Shine-Dalgarno Helix In
          The 70s Ribosome. This File, 2qnh, Contains The 30s
          Ribosome Subunit, Two Trna, And Mrna Molecules. 50s
          Ribosome Subunit Is In The File 1vsp.
 gi|186972868|pdb|2VQE|T Chain T, Modified Uridines With C5-Methylene Substituents At The
          First Position Of The Trna Anticodon Stabilize U-G
          Wobble Pairing During Decoding
 gi|186972891|pdb|2VQF|T Chain T, Modified Uridines With C5-Methylene Substituents At The
          First Position Of The Trna Anticodon Stabilize U-G
          Wobble Pairing During Decoding
 gi|209156515|pdb|3D5A|T Chain T, Structural Basis For Translation Termination On The 70s
          Ribosome. This File Contains The 30s Subunit, Release
          Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes As Described In Remark 400.
 gi|209156571|pdb|3D5C|T Chain T, Structural Basis For Translation Termination On The 70s
          Ribosome. This File Contains The 30s Subunit, Release
          Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes As Described In Remark 400.
 gi|218766792|pdb|3F1E|T Chain T, Crystal Structure Of A Translation Termination Complex
          Formed With Release Factor Rf2. This File Contains The
          30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One
          70s Ribosome. The Entire Crystal Structure Contains Two
          70s Ribosomes As Described In Remark 400.
 gi|218766848|pdb|3F1G|T Chain T, Crystal Structure Of A Translation Termination Complex
          Formed With Release Factor Rf2. This File Contains The
          30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes As Described In Remark 400.
 gi|307776631|pdb|3OTO|T Chain T, Crystal Structure Of The 30s Ribosomal Subunit From A
          Ksga Mutant Of Thermus Thermophilus (Hb8)
 gi|46196958|gb|AAS81373.1| SSU ribosomal protein S20P [Thermus thermophilus HB27]
          Length = 106

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 11 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGS 70

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 71 TLHKNAAARRKSRLMRKVRQLLEAA 95


>gi|89093567|ref|ZP_01166515.1| 30S ribosomal protein S20 [Oceanospirillum sp. MED92]
 gi|89082257|gb|EAR61481.1| 30S ribosomal protein S20 [Oceanospirillum sp. MED92]
          Length = 88

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   ++K  R+  +R   N S RS VR++++    A+  G    A EA + A+ ++  
Sbjct: 1  MANSAGSRKRARQAEKRRQHNASLRSMVRTYIKKVISAVEAGDQAVAQEAFKAAQPILDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKGIFH N  +R  SRLSK++ G+
Sbjct: 61 SVSKGIFHKNKIARTKSRLSKQIAGM 86


>gi|154245634|ref|YP_001416592.1| ribosomal protein S20 [Xanthobacter autotrophicus Py2]
 gi|226695443|sp|A7IFZ2|RS20_XANP2 RecName: Full=30S ribosomal protein S20
 gi|154159719|gb|ABS66935.1| ribosomal protein S20 [Xanthobacter autotrophicus Py2]
          Length = 89

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (69%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +RKI RRT +N+SRRS VR+++R   +A+T G    AT A + AE  I +
Sbjct: 1  MANTPSAKKAVRKIERRTEVNRSRRSRVRTYLRKLEDALTAGDATAATAAFQAAEPEIMR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N ASRKVSRL+ R+K +
Sbjct: 61 AVTKGVLHKNTASRKVSRLAARVKKL 86


>gi|325107236|ref|YP_004268304.1| 30S ribosomal protein S20P [Planctomyces brasiliensis DSM 5305]
 gi|324967504|gb|ADY58282.1| SSU ribosomal protein S20P [Planctomyces brasiliensis DSM 5305]
          Length = 94

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  +AKK +R+  +R L N+S+RS++R+ ++     +  G IE A  A R A   + +
Sbjct: 1  MPNTANAKKALRQSVKRRLHNRSQRSALRTAVKKVRALVASGDIEGAETAFRHATKRLDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A +K + H NAA+R  SRLSK +K
Sbjct: 61 AAAKNLIHRNAAARTKSRLSKFIK 84


>gi|149241294|pdb|2E5L|T Chain T, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna
          Via The Shine- Dalgarno Interaction
 gi|226887648|pdb|2ZM6|T Chain T, Crystal Structure Of The Thermus Thermophilus 30s
          Ribosomal Subunit
          Length = 105

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 10 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGS 69

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 70 TLHKNAAARRKSRLMRKVRQLLEAA 94


>gi|323483817|ref|ZP_08089195.1| 30S ribosomal protein S20 [Clostridium symbiosum WAL-14163]
 gi|323692781|ref|ZP_08107008.1| ribosomal protein S20 [Clostridium symbiosum WAL-14673]
 gi|323402839|gb|EGA95159.1| 30S ribosomal protein S20 [Clostridium symbiosum WAL-14163]
 gi|323503095|gb|EGB18930.1| ribosomal protein S20 [Clostridium symbiosum WAL-14673]
          Length = 87

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 46/81 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     R   NK+ RS V++  +    AIT G    A  A   A S I K
Sbjct: 1  MANIKSAKKRILVAETRAARNKAIRSKVKTVTKKVEAAITAGDKAAAQAALLVAISEIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG++H N ASRKVSRLSK
Sbjct: 61 ATSKGVYHKNTASRKVSRLSK 81


>gi|119477518|ref|ZP_01617709.1| Ribosomal protein S20p [marine gamma proteobacterium HTCC2143]
 gi|119449444|gb|EAW30683.1| Ribosomal protein S20p [marine gamma proteobacterium HTCC2143]
          Length = 88

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R   N S RS VR+ ++    AI  G  EEA +A   A  VI +
Sbjct: 1  MANSPQAKKRARQSEKRRQHNTSLRSVVRTSIKKVLAAIGTGNAEEAKKAYDAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N ASR  SRL+ ++K +
Sbjct: 61 MADKGILHKNKASRHKSRLNAQVKAL 86


>gi|88705557|ref|ZP_01103267.1| 30S ribosomal protein S20 [Congregibacter litoralis KT71]
 gi|88700070|gb|EAQ97179.1| 30S ribosomal protein S20 [Congregibacter litoralis KT71]
          Length = 88

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S RS VR+ +++   A+  G  E+A EA  KA  VI +
Sbjct: 1  MANSPQARKRARQSEKRRAHNASLRSLVRTNIKNVLAAVKTGDAEQAREAYSKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|85374939|ref|YP_459001.1| 30S ribosomal protein S20 [Erythrobacter litoralis HTCC2594]
 gi|123293671|sp|Q2N7Y7|RS20_ERYLH RecName: Full=30S ribosomal protein S20
 gi|84788022|gb|ABC64204.1| ribosomal protein S20 [Erythrobacter litoralis HTCC2594]
          Length = 86

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+  RR  +N +R S +RSF++    A+  G  + A  A ++A+  + +
Sbjct: 1  MANSPQAKKRIRRNDRRAEVNTARMSRIRSFVKKVETAVAEGDKKAAEAALKEAQPEMAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            ++G+ H N A+RK SRL+KR+
Sbjct: 61 GVARGVIHKNTAARKFSRLTKRV 83


>gi|34811548|pdb|1PNS|T Chain T, Crystal Structure Of A Streptomycin Dependent Ribosome
          From E. Coli, 30s Subunit Of 70s Ribosome. This File,
          1pns, Contains The 30s Subunit, Two Trnas, And One Mrna
          Molecule. The 50s Ribosomal Subunit Is In File 1pnu.
 gi|34811604|pdb|1PNX|T Chain T, Crystal Structure Of The Wild Type Ribosome From E.
          Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx,
          Contains Only Molecules Of The 30s Ribosomal Subunit.
          The 50s Subunit Is In The Pdb File 1pny.
 gi|56966342|pdb|1VOQ|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966395|pdb|1VOS|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966448|pdb|1VOV|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966501|pdb|1VOX|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966554|pdb|1VOZ|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|300508624|pdb|3MR8|T Chain T, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3mr8 Contains 30s Ribosomal Subunit.
          The 50s Ribosomal Subunit Can Be Found In Pdb Entry
          3ms1. Molecule B In The Same Asymmetric Unit Is
          Deposited As 3mrz (50s) And 3ms0 (30s).
 gi|300508679|pdb|3MS0|T Chain T, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3ms0 Contains 30s Ribosomal Subunit.
          The 50s Ribosomal Subunit Can Be Found In Pdb Entry
          3mrz. Molecule A In The Same Asymmetric Unit Is
          Deposited As 3mr8 (30s) And 3ms1 (50s).
 gi|322812569|pdb|3PYN|T Chain T, Crystal Structure Of A Complex Containing Domain 3 From
          The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome.
 gi|322812622|pdb|3PYQ|T Chain T, Crystal Structure Of A Complex Containing Domain 3 From
          The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome.
 gi|322812675|pdb|3PYS|T Chain T, Crystal Structure Of A Complex Containing Domain 3 Of
          Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
          Contains The 30s Subunit Of The First 70s Ribosome.
 gi|322812728|pdb|3PYU|T Chain T, Crystal Structure Of A Complex Containing Domain 3 Of
          Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
          Contains The 30s Subunit Of The Second 70s Ribosome
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 4  SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGS 63

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 64 TLHKNAAARRKSRLMRKVRQLLEAA 88


>gi|55981366|ref|YP_144663.1| 30S ribosomal protein S20 [Thermus thermophilus HB8]
 gi|20095227|sp|P80380|RS20_THET8 RecName: Full=30S ribosomal protein S20
 gi|14278075|pdb|1IBK|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With The Antibiotic Paromomycin
 gi|14278096|pdb|1IBL|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With A Messenger Rna Fragment And
          Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
          Site And With The Antibiotic Paromomycin
 gi|14278120|pdb|1IBM|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With A Messenger Rna Fragment And
          Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
          Site
 gi|27065895|pdb|1N32|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Bound To Codon And Near-Cognate Transfer Rna
          Anticodon Stem-Loop Mismatched At The First Codon
          Position At The A Site With Paromomycin
 gi|27065922|pdb|1N33|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Bound To Codon And Near-Cognate Transfer Rna
          Anticodon Stem-Loop Mismatched At The Second Codon
          Position At The A Site With Paromomycin
 gi|27065949|pdb|1N34|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In The Presence Of Codon And
          Crystallographically Disordered Near-Cognate Transfer
          Rna Anticodon Stem-Loop Mismatched At The First Codon
          Position
 gi|27065975|pdb|1N36|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In The Presence Of Crystallographically
          Disordered Codon And Near-Cognate Transfer Rna
          Anticodon Stem-Loop Mismatched At The Second Codon
          Position
 gi|58177419|pdb|1XMO|T Chain T, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed
          With Aag-Mrna In The Decoding Center
 gi|58177442|pdb|1XMQ|T Chain T, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To
          The Decoding Center
 gi|58177483|pdb|1XNQ|T Chain T, Structure Of An Inosine-Adenine Wobble Base Pair Complex
          In The Context Of The Decoding Center
 gi|58177506|pdb|1XNR|T Chain T, Crystal Structure Of An Inosine-Cytosine Wobble Base
          Pair In The Context Of The Decoding Center
 gi|116667673|pdb|2HHH|T Chain T, Crystal Structure Of Kasugamycin Bound To The 30s
          Ribosomal Subunit
 gi|116668216|pdb|2J00|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 1 Of
          4). This File Contains The 30s Subunit, Mrna, A-, P-
          And E-Site Trnas And Paromomycin For Molecule I.
 gi|116668277|pdb|2J02|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4)
          This File Contains The 30s Subunit, Mrna, A-, P- And
          E-Site Trnas And Paromomycin For Molecule Ii.
 gi|119389731|pdb|2HGI|W Chain W, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome Showing How The 16s 3'-End Mimicks Mrna E And
          P Codons. This Entry 2hgi Contains 30s Ribosomal
          Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb
          Entry 2hgj.
 gi|119389788|pdb|2HGP|W Chain W, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome With Translocated And Rotated Shine-Dalgarno
          Duplex. This Entry 2hgp Contains 30s Ribosomal Subunit.
          The 50s Ribosomal Subunit Can Be Found In Pdb Entry
          2hgq.
 gi|119389844|pdb|2HGR|W Chain W, 70s T.Th. Ribosome Functional Complex With Mrna And E-
          And P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s
          Ribosomal Subunit. The 50s Ribosomal Subunit Can Be
          Found In Pdb Entry 2hgu.
 gi|149243637|pdb|2UU9|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Gug-Codon In The
          A-Site And Paromomycin.
 gi|149243664|pdb|2UUA|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Guc-Codon In The
          A-Site And Paromomycin.
 gi|149243691|pdb|2UUB|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Guu-Codon In The
          A-Site And Paromomycin.
 gi|149243718|pdb|2UUC|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Gua-Codon In The
          A-Site And Paromomycin.
 gi|157836504|pdb|2V46|T Chain T, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 1 Of 4). This File Contains The 30s
          Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
          Molecule 1.
 gi|157836560|pdb|2V48|T Chain T, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 3 Of 4). This File Contains The 30s
          Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
          Molecule 2.
 gi|211938838|pdb|2JL5|T Chain T, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome (Part 1 Of 4).
          This File Contains The 30s Subunit.
 gi|211938896|pdb|2JL7|T Chain T, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome (Part 3 Of 4).
          This File Contains The 30s Subunit.
 gi|226887393|pdb|2WDG|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna.  This File
          Contains The 30s Subunit A-,P-, And E-Site Trnas And
          Paromomycin For Molecule I.
 gi|226887418|pdb|2WDH|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna.  This File
          Contains The 30s Subunit A-,P-, And E-Site Trnas And
          Paromomycin For Molecule Ii.
 gi|226887507|pdb|2WDK|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 30s
          Subunit A-,P-, And E-Site Trnas And Paromomycin For
          Molecule I.
 gi|226887564|pdb|2WDM|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 30s
          Subunit A-,P-, And E-Site Trnas And Paromomycin For
          Molecule Ii.
 gi|237823548|pdb|2WH1|T Chain T, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome
 gi|237823607|pdb|2WH3|T Chain T, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome). This File
          Contains The 30s Subunit.
 gi|260100005|pdb|3HUW|T Chain T, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P
          For Molecule I.
 gi|260100061|pdb|3HUY|T Chain T, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P
          For Molecule Ii.
 gi|261824503|pdb|2WRI|T Chain T, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State (Part 1 Of
          4).
 gi|261824565|pdb|2WRK|T Chain T, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State (Part 3 Of
          4).
 gi|261824627|pdb|2WRN|T Chain T, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 1 Of 4).
 gi|261824686|pdb|2WRQ|T Chain T, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 3 Of 4).
 gi|281307186|pdb|3KIQ|TT Chain t, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 1 Of 4)
 gi|281307244|pdb|3KIS|TT Chain t, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 3 Of 4)
 gi|281307302|pdb|3KIU|TT Chain t, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 1 Of 4)
 gi|281307360|pdb|3KIX|TT Chain t, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 3 Of 4)
 gi|288965623|pdb|3KNH|T Chain T, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule I
 gi|289526701|pdb|3KNJ|T Chain T, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule Ii'
 gi|289526726|pdb|3KNL|T Chain T, The Structures Of Capreomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule I
 gi|289526751|pdb|3KNN|T Chain T, The Structures Of Capreomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule Ii
 gi|294979523|pdb|3I8G|W Chain W, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s
          Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In
          The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
          (50s).
 gi|294979548|pdb|3I8H|W Chain W, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s
          Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In
          The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
          (30s).
 gi|294979607|pdb|3I9B|W Chain W, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule
          B. The 50s Subunit Can Be Found In Pdb Entry 3i9c.
          Molecule A In The S Asymmetric Unit Is Deposited As
          3i9d (30s) And 3i9e (50s)
 gi|294979661|pdb|3I9D|W Chain W, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule
          A. The 50s Subunit Can Be Found In Pdb Entry 3i9e.
          Molecule B In The S Asymmetric Unit Is Deposited As
          3i9b (30s) And 3i9c (50s)
 gi|295982094|pdb|2X9R|T Chain T, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 gi|295982153|pdb|2X9T|T Chain T, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 gi|307567981|pdb|2XFZ|T Chain T, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 1 Of 4)
 gi|307568039|pdb|2XG1|T Chain T, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 3 Of 4)
 gi|309320254|pdb|3OGE|T Chain T, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Chloramphenicol. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320275|pdb|3OGY|T Chain T, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Chloramphenicol. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320356|pdb|3OHC|T Chain T, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 30s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 gi|309320377|pdb|3OHD|T Chain T, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 30s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 gi|309320458|pdb|3OHY|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320509|pdb|3OI0|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320560|pdb|3OI2|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320611|pdb|3OI4|T Chain T, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|312207692|pdb|2XQD|T Chain T, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The
          70s Ribosome With A Gtp Analog
 gi|313754018|pdb|2XSY|T Chain T, Trna Tranlocation On The 70s Ribosome: The Pre-
          Translocational Translocation Intermediate Ti(Pre)
 gi|313754133|pdb|2XUY|T Chain T, Trna Tranlocation On The 70s Ribosome: The Post-
          Translocational Translocation Intermediate Ti(Post)
 gi|325533421|pdb|2Y0U|T Chain T, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 gi|325533480|pdb|2Y0W|T Chain T, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 gi|325533539|pdb|2Y0Y|T Chain T, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 gi|325533598|pdb|2Y10|T Chain T, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 gi|325533657|pdb|2Y12|T Chain T, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 gi|325533716|pdb|2Y14|T Chain T, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Cognate Codon On The 70s Ribosome.
 gi|325533775|pdb|2Y16|T Chain T, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Cognate Codon On The 70s Ribosome.
 gi|325533834|pdb|2Y18|T Chain T, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 gi|11125386|emb|CAC15067.1| ribosomal protein S20 [Thermus thermophilus]
 gi|55772779|dbj|BAD71220.1| 30S ribosomal protein S20 [Thermus thermophilus HB8]
          Length = 106

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 11 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGS 70

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 71 TLHKNAAARRKSRLMRKVRQLLEAA 95


>gi|120599904|ref|YP_964478.1| 30S ribosomal protein S20 [Shewanella sp. W3-18-1]
 gi|146292159|ref|YP_001182583.1| 30S ribosomal protein S20 [Shewanella putrefaciens CN-32]
 gi|166223987|sp|A4Y4A1|RS20_SHEPC RecName: Full=30S ribosomal protein S20
 gi|166223989|sp|A1RMM9|RS20_SHESW RecName: Full=30S ribosomal protein S20
 gi|120559997|gb|ABM25924.1| SSU ribosomal protein S20P [Shewanella sp. W3-18-1]
 gi|145563849|gb|ABP74784.1| SSU ribosomal protein S20P [Shewanella putrefaciens CN-32]
 gi|319425455|gb|ADV53529.1| ribosomal protein S20 [Shewanella putrefaciens 200]
          Length = 88

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIKAGDHKTATEAFAVAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ ++K I
Sbjct: 61 MATKGLIHKNKAARQKARLNAKIKAI 86


>gi|297559666|ref|YP_003678640.1| ribosomal protein S20 [Nocardiopsis dassonvillei subsp.
          dassonvillei DSM 43111]
 gi|296844114|gb|ADH66134.1| ribosomal protein S20 [Nocardiopsis dassonvillei subsp.
          dassonvillei DSM 43111]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK IR+  +  + N++ RSS+++ +R   EA   G +E+AT A R A   + K
Sbjct: 1  MANIKSQKKRIRQNEKARVRNQAVRSSLKTAVRKFREAAEAGDVEKATVAQRAAARALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H N A+ + S ++KRL  + ++
Sbjct: 61 ATSKGVIHQNQAANRKSAIAKRLHSLQSA 89


>gi|308069976|ref|YP_003871581.1| 30S ribosomal protein S20 [Paenibacillus polymyxa E681]
 gi|305859255|gb|ADM71043.1| 30S ribosomal protein S20 [Paenibacillus polymyxa E681]
          Length = 90

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++ A+ A+   + E A  A + A   + K
Sbjct: 1  MPNIKSAIKRVKTSDKRRALNASQKSALRTAVKAADTALVGNEAETAAAAFKVASQKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H NAA+RK SRL+K+L  +   A
Sbjct: 61 AVTKGLIHKNAAARKKSRLAKKLNALTAQA 90


>gi|255318942|ref|ZP_05360167.1| ribosomal protein S20 [Acinetobacter radioresistens SK82]
 gi|262378322|ref|ZP_06071479.1| ribosomal protein S20 [Acinetobacter radioresistens SH164]
 gi|255303959|gb|EET83151.1| ribosomal protein S20 [Acinetobacter radioresistens SK82]
 gi|262299607|gb|EEY87519.1| ribosomal protein S20 [Acinetobacter radioresistens SH164]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+       N S RS VR++++    AI  G    ATEA +KA  VI +
Sbjct: 1  MANSAQAKKRARQNVTARKHNASLRSMVRTYIKRTLSAIAAGDYAVATEAYKKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNTQVKAL 86


>gi|14278549|pdb|1I94|T Chain T, Crystal Structures Of The Small Ribosomal Subunit With
          Tetracycline, Edeine And If3
 gi|14278570|pdb|1I95|T Chain T, Crystal Structure Of The 30s Ribosomal Subunit From
          Thermus Thermophilus In Complex With Edeine
 gi|14278591|pdb|1I96|T Chain T, Crystal Structure Of The 30s Ribosomal Subunit From
          Thermus Thermophilus In Complex With The Translation
          Initiation Factor If3 (C-Terminal Domain)
 gi|14278613|pdb|1I97|T Chain T, Crystal Structure Of The 30s Ribosomal Subunit From
          Thermus Thermophilus In Complex With Tetracycline
          Length = 105

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 10 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGS 69

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 70 TLHKNAAARRKSRLMRKVRQLLEAA 94


>gi|257414008|ref|ZP_04744969.2| ribosomal protein S20 [Roseburia intestinalis L1-82]
 gi|257201504|gb|EEU99788.1| ribosomal protein S20 [Roseburia intestinalis L1-82]
 gi|291538273|emb|CBL11384.1| SSU ribosomal protein S20P [Roseburia intestinalis XB6B4]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     R   NK+ RS V++ ++    A+     E A  A   A S I+ 
Sbjct: 13 LANIKSAKKRILVTETRAARNKAIRSEVKTSIKKVEAAVAANDKEAAKAALTVAISTIES 72

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGI+H N ++RKVSRL+K + G+
Sbjct: 73 ASSKGIYHKNNSARKVSRLTKLVNGL 98


>gi|226946109|ref|YP_002801182.1| 30S ribosomal protein S20 [Azotobacter vinelandii DJ]
 gi|259494853|sp|C1DE99|RS20_AZOVD RecName: Full=30S ribosomal protein S20
 gi|226721036|gb|ACO80207.1| Ribosomal protein S20p [Azotobacter vinelandii DJ]
          Length = 91

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI    +++A  A   A  VI +
Sbjct: 1  MANSPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDLDKAKTAYTAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRL+  +K + T+A
Sbjct: 61 MADKGIIHKNKAARHKSRLNAHIKALGTAA 90


>gi|238019448|ref|ZP_04599874.1| hypothetical protein VEIDISOL_01317 [Veillonella dispar ATCC
          17748]
 gi|294791733|ref|ZP_06756881.1| ribosomal protein S20 [Veillonella sp. 6_1_27]
 gi|294793594|ref|ZP_06758731.1| ribosomal protein S20 [Veillonella sp. 3_1_44]
 gi|237864147|gb|EEP65437.1| hypothetical protein VEIDISOL_01317 [Veillonella dispar ATCC
          17748]
 gi|294455164|gb|EFG23536.1| ribosomal protein S20 [Veillonella sp. 3_1_44]
 gi|294456963|gb|EFG25325.1| ribosomal protein S20 [Veillonella sp. 6_1_27]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          + N  S+ + ++  A R   N + +S +R+  R   EA+  G +EEA +A   A SVI K
Sbjct: 4  LPNIKSSIRSVKTDAERRAKNAAVKSQIRTAARKTVEAVQAGAVEEAKQALVHATSVIDK 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK S L+ ++  +
Sbjct: 64 AASKGVLHKNTAARKKSNLAAKVNAL 89


>gi|134300344|ref|YP_001113840.1| 30S ribosomal protein S20 [Desulfotomaculum reducens MI-1]
 gi|172044334|sp|A4J7G2|RS20_DESRM RecName: Full=30S ribosomal protein S20
 gi|134053044|gb|ABO51015.1| SSU ribosomal protein S20P [Desulfotomaculum reducens MI-1]
          Length = 88

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +     RT+ N S +S+V++ +R   EA+     E A  A R A   + K
Sbjct: 1  MPNIKSAIKRVEITKARTIRNASIKSAVKTAIRRYEEALAKADKEVAETALRNAMVAVDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAA+RK SRL+KR   I
Sbjct: 61 AVTKGVLHKNAAARKKSRLTKRFNKI 86


>gi|224510696|pdb|3FIC|T Chain T, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
          And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
          6.4 A Cryo-Em Map. This File Contains The 30s Subunit
          And The Ligands
          Length = 99

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 4  SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGS 63

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 64 TLHKNAAARRKSRLMRKVRQLLEAA 88


>gi|323702391|ref|ZP_08114056.1| ribosomal protein S20 [Desulfotomaculum nigrificans DSM 574]
 gi|323532697|gb|EGB22571.1| ribosomal protein S20 [Desulfotomaculum nigrificans DSM 574]
          Length = 88

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +    +RTL N   +S+V++ +R   EA+     E A    RKA   + K
Sbjct: 1  MPNIKSAAKRVEITRKRTLRNARIKSAVKTAIRRYEEALNSANQELAQTTLRKALIALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG+ H NAA+RK SRL+KR 
Sbjct: 61 AVTKGVLHKNAAARKKSRLTKRF 83


>gi|309790001|ref|ZP_07684577.1| ribosomal protein S20 [Oscillochloris trichoides DG6]
 gi|308228021|gb|EFO81673.1| ribosomal protein S20 [Oscillochloris trichoides DG6]
          Length = 89

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K I   AR+   N+  RS V++ ++ A ++I  G  +EAT   R A S++ K
Sbjct: 1  MANTKSAQKRIGTNARKHARNQMYRSQVKTAVKKAEQSIFSGTPDEAT--IRAALSLLDK 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KGI H N A+R+ SRL K+L
Sbjct: 59 AAVKGIIHKNNAARRKSRLVKKL 81


>gi|293608218|ref|ZP_06690521.1| 30S ribosomal protein S20 [Acinetobacter sp. SH024]
 gi|292828791|gb|EFF87153.1| 30S ribosomal protein S20 [Acinetobacter sp. SH024]
 gi|325122051|gb|ADY81574.1| 30S ribosomal protein S20 [Acinetobacter calcoaceticus PHEA-2]
          Length = 88

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+       N S RS VR++++    AI  G    ATEA +KA  VI +
Sbjct: 1  MANSAQAKKRARQNVTARKHNASLRSMVRTYIKRTLSAIAGGDYAVATEAYKKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|85858022|ref|YP_460224.1| 30S ribosomal protein S20 [Syntrophus aciditrophicus SB]
 gi|108884802|sp|Q2LQK7|RS20_SYNAS RecName: Full=30S ribosomal protein S20
 gi|85721113|gb|ABC76056.1| SSU ribosomal protein S20 [Syntrophus aciditrophicus SB]
          Length = 89

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA   SA+K  R+I +R + N S RS V+++++    AI     E A  A ++A  VI K
Sbjct: 1  MATHKSAEKRSRQIEKRRIRNVSIRSKVKTYIKSVLTAIEAKDKEGAQSALQQAIPVIAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG++H   ASR +SRL++++
Sbjct: 61 AGAKGVYHQKTASRHISRLTRKV 83


>gi|148652754|ref|YP_001279847.1| 30S ribosomal protein S20 [Psychrobacter sp. PRwf-1]
 gi|172048522|sp|A5WE06|RS20_PSYWF RecName: Full=30S ribosomal protein S20
 gi|148571838|gb|ABQ93897.1| SSU ribosomal protein S20P [Psychrobacter sp. PRwf-1]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K +R+   R     S+RS +R++++  + AI  G  + AT A  KA  VI +
Sbjct: 1  MANSAQARKRVRQNNTRRQHAASQRSMIRTYIKKVDAAILAGDYDAATAAYNKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  SR +K +K +
Sbjct: 61 MADKGVIHKNKAARHKSRYNKAIKAL 86


>gi|83648579|ref|YP_437014.1| 30S ribosomal protein S20 [Hahella chejuensis KCTC 2396]
 gi|115305685|sp|Q2S9T5|RS20_HAHCH RecName: Full=30S ribosomal protein S20
 gi|83636622|gb|ABC32589.1| ribosomal protein S20 [Hahella chejuensis KCTC 2396]
          Length = 89

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK  R+  +R   N S RS VR++++  +  I  G  + AT+A   A  +I  
Sbjct: 1  MANNPSSKKRARQQVKRRAHNMSLRSMVRTYIKKVSAQIEQGSYDGATQALTTAAPIIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGIF  N A+R  SRL+ ++K +
Sbjct: 61 MVNKGIFSKNKAARTKSRLNAKIKAL 86


>gi|182438776|ref|YP_001826495.1| 30S ribosomal protein S20 [Streptomyces griseus subsp. griseus
          NBRC 13350]
 gi|326779431|ref|ZP_08238696.1| 30S ribosomal protein S20 [Streptomyces cf. griseus XylebKG-1]
 gi|226695427|sp|B1VY27|RS20_STRGG RecName: Full=30S ribosomal protein S20
 gi|178467292|dbj|BAG21812.1| putative 30S ribosomal protein S20 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|326659764|gb|EGE44610.1| 30S ribosomal protein S20 [Streptomyces cf. griseus XylebKG-1]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA+  G +E+AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAVVAGDVEKATTAVRDASRQLDKAVSKGVIHKNAAANKKSA 78

Query: 79 LSKRL 83
          L+ ++
Sbjct: 79 LASKV 83


>gi|317051815|ref|YP_004112931.1| 30S ribosomal protein S20 [Desulfurispirillum indicum S5]
 gi|316946899|gb|ADU66375.1| ribosomal protein S20 [Desulfurispirillum indicum S5]
          Length = 90

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SA+K IR+  ++   N   ++++R+F +  N+A+  G  E+     R+ +    +
Sbjct: 1  MAHTSSARKRIRQSQKKHARNSYVKTTLRTFNKKFNKAVEAGDKEQVQTLFRQCQKKFSQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A +KG+ H N ASRKVSRL++  K +L
Sbjct: 61 AAAKGVIHKNTASRKVSRLAQAAKKVL 87


>gi|226356166|ref|YP_002785906.1| 30S ribosomal protein S20 [Deinococcus deserti VCD115]
 gi|259494857|sp|C1CVD5|RS20_DEIDV RecName: Full=30S ribosomal protein S20
 gi|226318156|gb|ACO46152.1| putative 30S ribosomal protein S20 [Deinococcus deserti VCD115]
          Length = 91

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (2%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K  R+  +R ++N+SR+S++++F + A  A T G  E    A  KAES+I KA    
Sbjct: 7  SAQKRHRQSLKRRMLNRSRKSTIKTFTKQAVAAATTG--ENLAAAQSKAESLIDKAAKGS 64

Query: 66 IFHGNAASRKVSRLSK 81
            H NAA+RK SRL+K
Sbjct: 65 TLHKNAAARKKSRLAK 80


>gi|149195430|ref|ZP_01872513.1| 30S ribosomal protein S20 [Caminibacter mediatlanticus TB-2]
 gi|149134435|gb|EDM22928.1| 30S ribosomal protein S20 [Caminibacter mediatlanticus TB-2]
          Length = 90

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+ A+RT  N+  R+ +++  ++  +A+  G  E+A    + A    Q 
Sbjct: 1  MANTKSAQKRIRQTAKRTERNRYYRTRIKTITKNVEKAVEEGNYEQALNYWKVANKKFQS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGI   N A RK+SRL   +K I
Sbjct: 61 YINKGILKKNTARRKISRLHHLVKSI 86


>gi|237751774|ref|ZP_04582254.1| 30s ribosomal protein s20 [Helicobacter bilis ATCC 43879]
 gi|229373140|gb|EEO23531.1| 30s ribosomal protein s20 [Helicobacter bilis ATCC 43879]
          Length = 90

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 53/90 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  R+ +++  +   EA+    +++A EA + A   I K
Sbjct: 1  MANHKSAEKRIRQTEKRTERNRYYRTRLKNITKAVREAVASKDLDKANEAFKIANKEIHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKGI   N A+RKVSRL+  +K +  +A
Sbjct: 61 FVSKGILKKNTAARKVSRLNSAVKKLSQAA 90


>gi|297199605|ref|ZP_06917002.1| ribosomal protein S20 [Streptomyces sviceus ATCC 29083]
 gi|197713467|gb|EDY57501.1| ribosomal protein S20 [Streptomyces sviceus ATCC 29083]
          Length = 86

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NK+ +SS+++ +R A EA   G +E+ATE  R A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNKAVKSSLKTAIRKAREAAAAGDVEKATEYQRAAARALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ K S L+ ++ G+
Sbjct: 61 AVSKGVIHKNQAANKKSALASKVAGL 86


>gi|224373414|ref|YP_002607786.1| 30S ribosomal protein S20 [Nautilia profundicola AmH]
 gi|254813091|sp|B9L5Z8|RS20_NAUPA RecName: Full=30S ribosomal protein S20
 gi|223588873|gb|ACM92609.1| ribosomal protein S20 [Nautilia profundicola AmH]
          Length = 90

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 48/90 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K IR+  +RT  N+  R+ +++  +    A+  G  E A EA ++A    Q 
Sbjct: 1  MANNKSALKRIRQTKKRTERNRYFRTRIKTITKKVESAVAEGNYEAALEAWKEANKKFQG 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +KGI   N A RK+SRL   +K I  SA
Sbjct: 61 YINKGILKKNTARRKISRLHHLVKSIEPSA 90


>gi|149377785|ref|ZP_01895518.1| ribosomal protein S20 [Marinobacter algicola DG893]
 gi|149357957|gb|EDM46446.1| ribosomal protein S20 [Marinobacter algicola DG893]
          Length = 89

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS  R++++     I  GK EEA  A +KA+ ++  
Sbjct: 1  MANTPQAKKRARQNEKNRKHNASLRSMARTYIKKVQANIEAGKPEEAQAALQKAQPIMDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+F  N  +R+ SRLS R+K +
Sbjct: 61 MVNKGVFAKNKIARQKSRLSARIKAL 86


>gi|283782393|ref|YP_003373148.1| 30S ribosomal protein S20 [Pirellula staleyi DSM 6068]
 gi|283440846|gb|ADB19288.1| ribosomal protein S20 [Pirellula staleyi DSM 6068]
          Length = 93

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M    SAKK +R+   +  IN++ +SSV++ +R   EA+T G    AT    KA S + +
Sbjct: 1  MPTTKSAKKRLRQSNEKRAINRATKSSVKTQIRKVREAVTAGDFTTATTEFNKAASKLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +K + H N ASR  SRLS  L
Sbjct: 61 AGAKRVIHPNVASRTKSRLSAML 83


>gi|15611142|ref|NP_222793.1| 30S ribosomal protein S20 [Helicobacter pylori J99]
 gi|108562502|ref|YP_626818.1| 30S ribosomal protein S20 [Helicobacter pylori HPAG1]
 gi|208434042|ref|YP_002265708.1| ribosomal protein S20 [Helicobacter pylori G27]
 gi|210134281|ref|YP_002300720.1| 30S ribosomal protein S20 [Helicobacter pylori P12]
 gi|217034577|ref|ZP_03439985.1| hypothetical protein HP9810_903g2 [Helicobacter pylori 98-10]
 gi|7388187|sp|Q9ZMZ1|RS20_HELPJ RecName: Full=30S ribosomal protein S20
 gi|118573821|sp|Q1CV78|RS20_HELPH RecName: Full=30S ribosomal protein S20
 gi|226736503|sp|B6JPH9|RS20_HELP2 RecName: Full=30S ribosomal protein S20
 gi|226736504|sp|B5Z679|RS20_HELPG RecName: Full=30S ribosomal protein S20
 gi|4154580|gb|AAD05655.1| 30S RIBOSOMAL PROTEIN S20 [Helicobacter pylori J99]
 gi|107836275|gb|ABF84144.1| ribosomal protein S20 [Helicobacter pylori HPAG1]
 gi|208431971|gb|ACI26842.1| ribosomal protein S20 [Helicobacter pylori G27]
 gi|210132249|gb|ACJ07240.1| ribosomal protein S20 [Helicobacter pylori P12]
 gi|216942932|gb|EEC22417.1| hypothetical protein HP9810_903g2 [Helicobacter pylori 98-10]
 gi|261838949|gb|ACX98714.1| ribosomal protein S20 [Helicobacter pylori 52]
 gi|297379297|gb|ADI34184.1| ribosomal protein S20 [Helicobacter pylori v225d]
 gi|315586074|gb|ADU40455.1| 30S ribosomal protein S20 [Helicobacter pylori 35A]
 gi|317011920|gb|ADU82528.1| 30S ribosomal protein S20 [Helicobacter pylori Lithuania75]
 gi|317181377|dbj|BAJ59161.1| 30S ribosomal protein S20 [Helicobacter pylori F57]
 gi|332672915|gb|AEE69732.1| 30S ribosomal protein S20 [Helicobacter pylori 83]
          Length = 89

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ V++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKAVREAVAINDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|315650235|ref|ZP_07903308.1| 30S ribosomal protein S20 [Eubacterium saburreum DSM 3986]
 gi|315487480|gb|EFU77789.1| 30S ribosomal protein S20 [Eubacterium saburreum DSM 3986]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+    RT  NK+ RS V++ ++    A+     + A    + A   I K
Sbjct: 1  MANIKSAKKRIKVTLVRTERNKAIRSKVKTAIKKVESAVAASDKQLAQANLKNAVVEITK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N ASRKV+RLSK +  I
Sbjct: 61 AASKGVYHKNNASRKVARLSKAVDSI 86


>gi|308061371|gb|ADO03259.1| 30S ribosomal protein S20 [Helicobacter pylori Cuz20]
          Length = 89

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ V++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKAVREAVAVNDVTKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|308062939|gb|ADO04826.1| 30S ribosomal protein S20 [Helicobacter pylori Sat464]
          Length = 89

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ V++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKTVREAVAVNDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|114564057|ref|YP_751571.1| 30S ribosomal protein S20 [Shewanella frigidimarina NCIMB 400]
 gi|122299065|sp|Q07Z32|RS20_SHEFN RecName: Full=30S ribosomal protein S20
 gi|114335350|gb|ABI72732.1| SSU ribosomal protein S20P [Shewanella frigidimarina NCIMB 400]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKRVIAAIKSGDHKAATEAFAIAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A R+ +RL+ ++K I
Sbjct: 61 MATKGLIHKNKAGRQKARLNAKIKAI 86


>gi|255525335|ref|ZP_05392275.1| ribosomal protein S20 [Clostridium carboxidivorans P7]
 gi|296188203|ref|ZP_06856595.1| ribosomal protein S20 [Clostridium carboxidivorans P7]
 gi|255511007|gb|EET87307.1| ribosomal protein S20 [Clostridium carboxidivorans P7]
 gi|296047329|gb|EFG86771.1| ribosomal protein S20 [Clostridium carboxidivorans P7]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL N+  +S++++ ++    AIT G  EEA      A   +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNRMIKSALKTAIKKFEVAITSGNAEEAKTTFVGAVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+R  SRLS +LK +
Sbjct: 61 AASKGVVHKNKAARSKSRLSAKLKSL 86


>gi|168187883|ref|ZP_02622518.1| ribosomal protein S20 [Clostridium botulinum C str. Eklund]
 gi|169294258|gb|EDS76391.1| ribosomal protein S20 [Clostridium botulinum C str. Eklund]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +S++++ +++   A+    + EA  A       +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMIKSALKTKIKNFEVAVANNDLNEAKSAYTTVVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+RK SRL+ RL G+
Sbjct: 61 AAAKGILHKNKAARKKSRLATRLSGL 86


>gi|119774058|ref|YP_926798.1| 30S ribosomal protein S20 [Shewanella amazonensis SB2B]
 gi|166223983|sp|A1S422|RS20_SHEAM RecName: Full=30S ribosomal protein S20
 gi|119766558|gb|ABL99128.1| SSU ribosomal protein S20P [Shewanella amazonensis SB2B]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  +AKK   +  +R   N SRRS +R++++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKTAKKRAIQSEKRRQHNASRRSMLRTYVKKVIAAIKTGDHKAATEAFAVAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ R+K +
Sbjct: 61 MATKGLIHKNKAARQKARLNARIKAL 86


>gi|24375041|ref|NP_719084.1| 30S ribosomal protein S20 [Shewanella oneidensis MR-1]
 gi|59798906|sp|Q8EBH9|RS20_SHEON RecName: Full=30S ribosomal protein S20
 gi|24349784|gb|AAN56528.1|AE015789_15 ribosomal protein S20 [Shewanella oneidensis MR-1]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 52/87 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIRAGDHKTATEAFAAAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            +KG+ H N A+R  +RL+ ++K ++
Sbjct: 61 MATKGLIHKNKAARHKARLNAKIKALV 87


>gi|224369809|ref|YP_002603973.1| RpsT [Desulfobacterium autotrophicum HRM2]
 gi|259494859|sp|C0QI73|RS20_DESAH RecName: Full=30S ribosomal protein S20
 gi|223692526|gb|ACN15809.1| RpsT [Desulfobacterium autotrophicum HRM2]
          Length = 83

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++   R L NKS RSS+ + ++    A   G  + AT+    A+S+I K
Sbjct: 1  MANHKSAAKRAKQSEARRLRNKSTRSSMNTAVKKVRTAKEAG-TDNATDLLNSAKSLIAK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H N A+RK+SRL+K L
Sbjct: 60 AAKKGVIHQNTAARKISRLTKSL 82


>gi|148657184|ref|YP_001277389.1| 30S ribosomal protein S20 [Roseiflexus sp. RS-1]
 gi|166223981|sp|A5UXT6|RS20_ROSS1 RecName: Full=30S ribosomal protein S20
 gi|148569294|gb|ABQ91439.1| SSU ribosomal protein S20P [Roseiflexus sp. RS-1]
          Length = 90

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR  ARR L NK  RS V++ ++ A  AI  G      E  R+A S++ +
Sbjct: 1  MANTKSAEKRIRANARRALRNKMYRSRVKTAIKKAERAIFAGTPN--AELVREAMSLLDR 58

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A  KGI H N A+R+ SRL
Sbjct: 59 AAVKGIIHKNNAARRKSRL 77


>gi|301059431|ref|ZP_07200352.1| ribosomal protein S20 [delta proteobacterium NaphS2]
 gi|300446467|gb|EFK10311.1| ribosomal protein S20 [delta proteobacterium NaphS2]
          Length = 73

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK  ++SV+  ++    AI+    E+A E   KA S+IQK+ SKG+ H N A+RKVSRL+
Sbjct: 3  NKGYKTSVKKAVKEVRAAISENTPEQAKETLNKAVSIIQKSASKGVIHKNQAARKVSRLT 62


>gi|150390806|ref|YP_001320855.1| ribosomal protein S20 [Alkaliphilus metalliredigens QYMF]
 gi|167011207|sp|A6TSM8|RS20_ALKMQ RecName: Full=30S ribosomal protein S20
 gi|149950668|gb|ABR49196.1| ribosomal protein S20 [Alkaliphilus metalliredigens QYMF]
          Length = 87

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 52/83 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K I+ IA++T  N+  +S +++ ++   EA+  G +EEA       E  + +
Sbjct: 1  MANIKSAQKRIKVIAKKTARNRMIKSQLKTAIKRFEEAVEAGNLEEAKVKLTFVEKKLSQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG  H ++ASRK+SRL+ RL
Sbjct: 61 AAAKGTVHKSSASRKISRLAIRL 83


>gi|91762460|ref|ZP_01264425.1| ribosomal protein S20 [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718262|gb|EAS84912.1| ribosomal protein S20 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 107

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SA K IR+IA +TL+NK+R+S  R+ ++  N  +   K +EA +   K  S + K
Sbjct: 22  MANTKSAIKRIRRIATQTLVNKARKSKYRNAIKKMNLLLVEKKKDEALKFLPKLNSELMK 81

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
               GI     ASR +SR++K++  +
Sbjct: 82  VAKTGIIKKANASRNISRITKKISAL 107


>gi|153873844|ref|ZP_02002288.1| Ribosomal protein S20 [Beggiatoa sp. PS]
 gi|152069691|gb|EDN67711.1| Ribosomal protein S20 [Beggiatoa sp. PS]
          Length = 102

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R   N SRRS +R++++   +AI     EEA  A + A  +I +
Sbjct: 1  MANSAQAKKRARQSEKRRQHNASRRSMLRTYIKKVVKAIDNRNSEEARVAYQVAVPIIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI H N A+R  SRL  R++ I
Sbjct: 61 MASKGIIHKNKAARHKSRLYSRIRTI 86


>gi|296133954|ref|YP_003641201.1| ribosomal protein S20 [Thermincola sp. JR]
 gi|296032532|gb|ADG83300.1| ribosomal protein S20 [Thermincola potens JR]
          Length = 88

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +    +RTL N + +SSV++ +R    A+    I+EA      A S + K
Sbjct: 1  MPNIKSAMKRVEITKKRTLRNSAIKSSVKTAIRKFENALENANIDEAKAKLTVAISALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N+A+RK SRL K+L+ +
Sbjct: 61 AVTKGVLHKNSAARKKSRLVKKLQKV 86


>gi|258516395|ref|YP_003192617.1| 30S ribosomal protein S20 [Desulfotomaculum acetoxidans DSM 771]
 gi|257780100|gb|ACV63994.1| ribosomal protein S20 [Desulfotomaculum acetoxidans DSM 771]
          Length = 88

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++ I  RTL N   +S +++ +R   +A+     EE     R+A  ++ K
Sbjct: 1  MPNIKSAAKRVKTIRARTLRNNIVKSQIKTAIRRFEDALAKSTPEEVQTVLRRALVLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+RK SRL+K+ 
Sbjct: 61 AASKGVLHKNKAARKKSRLTKQF 83


>gi|315453083|ref|YP_004073353.1| 30S ribosomal protein S20 [Helicobacter felis ATCC 49179]
 gi|315132135|emb|CBY82763.1| 30S ribosomal protein S20 [Helicobacter felis ATCC 49179]
          Length = 91

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++ ++   EA+    + +A +A + A   + K
Sbjct: 1  MANHKSAEKRIRQTLKRTERNRFYKTRLKNIVKAVREAVAHNDVPKAQDALKVANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGVLKKNTASRKVSRLNASVKKI 86


>gi|188526882|ref|YP_001909569.1| 30S ribosomal protein S20 [Helicobacter pylori Shi470]
 gi|207091638|ref|ZP_03239425.1| 30S ribosomal protein S20 [Helicobacter pylori HPKX_438_AG0C1]
 gi|308182252|ref|YP_003926379.1| 30S ribosomal protein S20 [Helicobacter pylori PeCan4]
 gi|226736505|sp|B2URQ7|RS20_HELPS RecName: Full=30S ribosomal protein S20
 gi|188143122|gb|ACD47539.1| 30S ribosomal protein S20 [Helicobacter pylori Shi470]
 gi|261837534|gb|ACX97300.1| ribosomal protein S20 [Helicobacter pylori 51]
 gi|308064437|gb|ADO06329.1| 30S ribosomal protein S20 [Helicobacter pylori PeCan4]
 gi|317176896|dbj|BAJ54685.1| 30S ribosomal protein S20 [Helicobacter pylori F16]
 gi|317179533|dbj|BAJ57321.1| 30S ribosomal protein S20 [Helicobacter pylori F30]
 gi|317179882|dbj|BAJ57668.1| 30S ribosomal protein S20 [Helicobacter pylori F32]
          Length = 89

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ V++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKAVREAVAVNDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|7388172|sp|O67643|RS20_AQUAE RecName: Full=30S ribosomal protein S20
          Length = 94

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N   AKK +R+ A+R L N+   S +R+++++    I  G+I++A E   +  SVI  
Sbjct: 1  MPNTRQAKKRMRRDAKRRLRNRYHLSRMRTYIKNFRRMIENGEIDKAKEYINEVISVIYH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            +KG+ H N A+R+ SR+ K L   L
Sbjct: 61 TAAKGVIHKNEAARRASRVYKLLNKAL 87


>gi|71083114|ref|YP_265833.1| 30S ribosomal protein S20 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|115305697|sp|Q4FNK9|RS20_PELUB RecName: Full=30S ribosomal protein S20
 gi|71062227|gb|AAZ21230.1| ribosomal protein S20 [Candidatus Pelagibacter ubique HTCC1062]
          Length = 86

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K IR+IA +TL+NK+R+S  R+ ++  N  +   K +EA +   K  S + K
Sbjct: 1  MANTKSAIKRIRRIATQTLVNKARKSKYRNAIKKMNLLLVEKKKDEALKFLPKLNSELMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
              GI     ASR +SR++K++  +
Sbjct: 61 VAKTGIIKKANASRNISRITKKISAL 86


>gi|113971295|ref|YP_735088.1| 30S ribosomal protein S20 [Shewanella sp. MR-4]
 gi|114048533|ref|YP_739083.1| 30S ribosomal protein S20 [Shewanella sp. MR-7]
 gi|117921578|ref|YP_870770.1| 30S ribosomal protein S20 [Shewanella sp. ANA-3]
 gi|123030377|sp|Q0HS79|RS20_SHESR RecName: Full=30S ribosomal protein S20
 gi|123324763|sp|Q0HFY6|RS20_SHESM RecName: Full=30S ribosomal protein S20
 gi|166223988|sp|A0KZZ5|RS20_SHESA RecName: Full=30S ribosomal protein S20
 gi|113885979|gb|ABI40031.1| SSU ribosomal protein S20P [Shewanella sp. MR-4]
 gi|113889975|gb|ABI44026.1| SSU ribosomal protein S20P [Shewanella sp. MR-7]
 gi|117613910|gb|ABK49364.1| SSU ribosomal protein S20P [Shewanella sp. ANA-3]
          Length = 88

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIKAGDHKTATEAFAAAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKARLNAKIKAL 86


>gi|152998228|ref|YP_001343063.1| 30S ribosomal protein S20 [Marinomonas sp. MWYL1]
 gi|189044869|sp|A6W349|RS20_MARMS RecName: Full=30S ribosomal protein S20
 gi|150839152|gb|ABR73128.1| ribosomal protein S20 [Marinomonas sp. MWYL1]
          Length = 87

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  +    N S RS VR++++  + AI  G   +A  A   A S + K
Sbjct: 1  MANSAGSKKRARQAVKSRAHNGSLRSMVRTYLKKVDAAIEAGNQADAQAAYVLATSKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG++H N A+R  SRLS ++K +
Sbjct: 61 AADKGLYHKNKAARHKSRLSAKIKAL 86


>gi|153005577|ref|YP_001379902.1| 30S ribosomal protein S20 [Anaeromyxobacter sp. Fw109-5]
 gi|166200009|sp|A7HDX2|RS20_ANADF RecName: Full=30S ribosomal protein S20
 gi|152029150|gb|ABS26918.1| ribosomal protein S20 [Anaeromyxobacter sp. Fw109-5]
          Length = 90

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 49/79 (62%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +R   N   R+ V+S ++ A EAIT G    A +A + A   ++K
Sbjct: 1  MANTASAEKRNRQAQKRRARNVQVRTGVKSAVKKAREAITQGDGNAARDAFKAAARALEK 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A SKG+ H NAASRK+SRL
Sbjct: 61 ASSKGVVHKNAASRKISRL 79


>gi|15606829|ref|NP_214209.1| ribosomal protein S20 [Aquifex aeolicus VF5]
 gi|2984069|gb|AAC07609.1| ribosomal protein S20 [Aquifex aeolicus VF5]
          Length = 113

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           M N   AKK +R+ A+R L N+   S +R+++++    I  G+I++A E   +  SVI  
Sbjct: 20  MPNTRQAKKRMRRDAKRRLRNRYHLSRMRTYIKNFRRMIENGEIDKAKEYINEVISVIYH 79

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGIL 87
             +KG+ H N A+R+ SR+ K L   L
Sbjct: 80  TAAKGVIHKNEAARRASRVYKLLNKAL 106


>gi|332978400|gb|EGK15117.1| trigger factor [Psychrobacter sp. 1501(2011)]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R     S+RS +R++++  + AI  G  E AT A  KA  VI +
Sbjct: 1  MANSAQARKRARQNNTRRQHAASQRSMIRTYIKKVDAAILAGDYEAATAAYNKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  SR +K +K +
Sbjct: 61 MADKGVIHKNKAARHKSRYNKAIKAL 86


>gi|167630489|ref|YP_001680988.1| 30S ribosomal protein s20 [Heliobacterium modesticaldum Ice1]
 gi|226736502|sp|B0TAC7|RS20_HELMI RecName: Full=30S ribosomal protein S20
 gi|167593229|gb|ABZ84977.1| 30S ribosomal protein s20 [Heliobacterium modesticaldum Ice1]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 2/84 (2%)

Query: 1  MANKDSAKKMIRKIAR-RTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59
          M N  SA K + KIAR RTL N S RS++R+ ++    A+    ++ A  A  KA   + 
Sbjct: 1  MPNIKSAIKRV-KIARERTLKNASARSALRTTLKRFEAALASADVDNARAALAKAVRALD 59

Query: 60 KAKSKGIFHGNAASRKVSRLSKRL 83
          KA +KG+ H N ASRK SR++KR 
Sbjct: 60 KAAAKGLIHKNTASRKKSRITKRF 83


>gi|307824931|ref|ZP_07655153.1| ribosomal protein S20 [Methylobacter tundripaludum SV96]
 gi|307733978|gb|EFO04833.1| ribosomal protein S20 [Methylobacter tundripaludum SV96]
          Length = 87

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +  + N  +RS++R+F++    A+  G  E+A  A   A  +I  
Sbjct: 1  MANTAQAKKRARQAEKSRIRNAGQRSNLRTFIKKIIAAVKLGDKEKAQAAYNTAVPIIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+R  SRL+ ++K I
Sbjct: 61 AVTKGIIHKNKAARGKSRLNAKVKAI 86


>gi|254382709|ref|ZP_04998066.1| 30S ribosomal protein S20 [Streptomyces sp. Mg1]
 gi|194341611|gb|EDX22577.1| 30S ribosomal protein S20 [Streptomyces sp. Mg1]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA+  G +E+AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAVLAGDVEKATVASRDAARALDKAVSKGVIHKNAAANKKSA 78

Query: 79 LSKRL 83
          L+ ++
Sbjct: 79 LASKV 83


>gi|238060578|ref|ZP_04605287.1| 30S ribosomal protein S20 [Micromonospora sp. ATCC 39149]
 gi|237882389|gb|EEP71217.1| 30S ribosomal protein S20 [Micromonospora sp. ATCC 39149]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +R L NKS +SS+++ +R  NEA+  G  E+AT   R A   + K
Sbjct: 1  MANIKSQIKRNRQNEKRRLRNKSVKSSLKTAVRKFNEAVEAGDAEKATALMRDASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S ++KR+
Sbjct: 61 AVSKGVIHSNQAANRKSAIAKRV 83


>gi|302551348|ref|ZP_07303690.1| ribosomal protein S20 [Streptomyces viridochromogenes DSM 40736]
 gi|302468966|gb|EFL32059.1| ribosomal protein S20 [Streptomyces viridochromogenes DSM 40736]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 53/88 (60%), Gaps = 3/88 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NK+ +SS+++ +R A EA+  G +E+ATE  R A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNKAVKSSLKTAIRKAREAVAAGDVEKATEYQRVAARQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKR---LKG 85
          A SKG+ H N A+ K S L+++   LKG
Sbjct: 61 AVSKGVIHKNQAANKKSALAQKVAALKG 88


>gi|227499821|ref|ZP_03929916.1| 30S ribosomal protein S20 [Anaerococcus tetradius ATCC 35098]
 gi|227218125|gb|EEI83393.1| 30S ribosomal protein S20 [Anaerococcus tetradius ATCC 35098]
          Length = 103

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 1   MANKDSAKKMIRKIARR-TLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59
           MAN  S+KK I  IARR T  NKSR+S +++ ++  + AI    +E+AT   +KA+  ++
Sbjct: 16  MANIKSSKKRI-DIARRNTERNKSRKSEIKTLIKKFDAAIEEKDLEKATSYFKKADKRLK 74

Query: 60  KAKSKGIFHGNAASRKVSRLSKRLKGI 86
           +A++K + H N  +R  SRL+K L  I
Sbjct: 75  QAEAKNVVHKNKVARTTSRLAKALNEI 101


>gi|254778802|ref|YP_003056907.1| 30S ribosomal protein S20 [Helicobacter pylori B38]
 gi|254000713|emb|CAX28629.1| 30S ribosomal subunit protein S20 [Helicobacter pylori B38]
 gi|317008749|gb|ADU79329.1| 30S ribosomal protein S20 [Helicobacter pylori India7]
          Length = 89

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKIKNIIKAVREAVAINDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|299770367|ref|YP_003732393.1| 30S ribosomal protein S20 [Acinetobacter sp. DR1]
 gi|298700455|gb|ADI91020.1| 30S ribosomal protein S20 [Acinetobacter sp. DR1]
          Length = 88

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+       N S RS VR++++    AI  G    ATEA +KA  VI +
Sbjct: 1  MANSAQAKKRARQNVTARKHNASLRSMVRTYIKRTLSAIAGGDHAVATEAYKKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|302342848|ref|YP_003807377.1| ribosomal protein S20 [Desulfarculus baarsii DSM 2075]
 gi|301639461|gb|ADK84783.1| ribosomal protein S20 [Desulfarculus baarsii DSM 2075]
          Length = 88

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +R + NKS R+++R  +R   +A+  G    A +A + A  VI K
Sbjct: 1  MANHQSALKRARQSEKRRIRNKSVRTNLRRTIRTVRQAVEAGDAAVAQQALQAAIPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N ASRK+SRL+ ++  +
Sbjct: 61 AASKGVIHRNNASRKISRLAMKVNAL 86


>gi|262278948|ref|ZP_06056733.1| ribosomal protein S20 [Acinetobacter calcoaceticus RUH2202]
 gi|262259299|gb|EEY78032.1| ribosomal protein S20 [Acinetobacter calcoaceticus RUH2202]
          Length = 88

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+       N S RS VR++++    AI  G    ATEA +KA  VI +
Sbjct: 1  MANSAQAKKRARQNVTARKHNASLRSMVRTYIKRTLSAIAGGDHAVATEAYQKAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|218133044|ref|ZP_03461848.1| hypothetical protein BACPEC_00906 [Bacteroides pectinophilus ATCC
          43243]
 gi|217991917|gb|EEC57921.1| hypothetical protein BACPEC_00906 [Bacteroides pectinophilus ATCC
          43243]
          Length = 87

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 50/81 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +     RT  NK+ +S V++++++   AI  G    A  A  +A  VI K
Sbjct: 1  MANIKSAKKRVLTTEVRTARNKAIKSKVKTYVKNVESAIAAGDKAAAQAALTEAIGVISK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKGI+H N A+RKVSRL+K
Sbjct: 61 AASKGIYHKNTAARKVSRLTK 81


>gi|90416599|ref|ZP_01224530.1| 30S ribosomal protein S20 [marine gamma proteobacterium HTCC2207]
 gi|90331798|gb|EAS47026.1| 30S ribosomal protein S20 [marine gamma proteobacterium HTCC2207]
          Length = 87

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R   N S RS VR++++  + AI  G   +A +A   A  V+ +
Sbjct: 1  MANSVQAKKRARQNEKRRQHNASLRSMVRTYLKKVDAAIESGVQADAQQAYTAAVPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGILHKNKAARHKSRLNAKVKAL 86


>gi|282861825|ref|ZP_06270889.1| ribosomal protein S20 [Streptomyces sp. ACTE]
 gi|282563641|gb|EFB69179.1| ribosomal protein S20 [Streptomyces sp. ACTE]
          Length = 88

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G +E+AT A R A   + KA SKG+ H N+A+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAAAAGDVEKATVAARDASRALDKAVSKGVIHKNSAANKKSA 78

Query: 79 LSKRLKGI 86
          L+ ++ G+
Sbjct: 79 LAVKVAGL 86


>gi|302389462|ref|YP_003825283.1| SSU ribosomal protein S20P [Thermosediminibacter oceani DSM
          16646]
 gi|302200090|gb|ADL07660.1| SSU ribosomal protein S20P [Thermosediminibacter oceani DSM
          16646]
          Length = 90

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 51/84 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK +R+  +RTL N+  +S +++ ++  NEA+    +E    A   A   + K
Sbjct: 1  MPNTASAKKKMRQARKRTLRNRLVKSKIKAAIKKFNEALKLQDVENIKSALIGAVKALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A SKG+ H NAA+RK SRL K+LK
Sbjct: 61 AASKGVIHKNAAARKKSRLYKKLK 84


>gi|15644706|ref|NP_206876.1| 30S ribosomal protein S20 [Helicobacter pylori 26695]
 gi|217033145|ref|ZP_03438605.1| hypothetical protein HPB128_185g5 [Helicobacter pylori B128]
 gi|298736979|ref|YP_003729509.1| 30S ribosomal protein S20 [Helicobacter pylori B8]
 gi|308183874|ref|YP_003928007.1| 30S ribosomal protein S20 [Helicobacter pylori SJM180]
 gi|2500482|sp|P56027|RS20_HELPY RecName: Full=30S ribosomal protein S20
 gi|2313157|gb|AAD07147.1| ribosomal protein S20 (rps20) [Helicobacter pylori 26695]
 gi|216945130|gb|EEC23828.1| hypothetical protein HPB128_185g5 [Helicobacter pylori B128]
 gi|298356173|emb|CBI67045.1| small subunit ribosomal protein S20 [Helicobacter pylori B8]
 gi|307636765|gb|ADN79215.1| SSU ribosomal protein s20p [Helicobacter pylori 908]
 gi|308059794|gb|ADO01690.1| 30S ribosomal protein S20 [Helicobacter pylori SJM180]
 gi|317013500|gb|ADU80936.1| 30S ribosomal protein S20 [Helicobacter pylori Gambia94/24]
 gi|325995351|gb|ADZ50756.1| 30S ribosomal protein S20 [Helicobacter pylori 2018]
 gi|325996948|gb|ADZ49156.1| 30S ribosomal protein S20 [Helicobacter pylori 2017]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKIKNIIKAVREAVAVNDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|270159206|ref|ZP_06187862.1| ribosomal protein S20 [Legionella longbeachae D-4968]
 gi|289165968|ref|YP_003456106.1| 30S ribosomal subunit protein S20 [Legionella longbeachae NSW150]
 gi|269987545|gb|EEZ93800.1| ribosomal protein S20 [Legionella longbeachae D-4968]
 gi|288859141|emb|CBJ13070.1| 30S ribosomal subunit protein S20 [Legionella longbeachae NSW150]
          Length = 88

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +    N S RS  R+++++  +A+  G  E A  A  KA+ VI K
Sbjct: 1  MANIKSAIKRARQNIKLRQHNASARSMFRTYIKNVLKAVESGDKEAALAAYTKAQPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N A+R  SRL  R+KG+
Sbjct: 61 AAGKGLIHKNKAARIKSRLVARVKGM 86


>gi|291458002|ref|ZP_06597392.1| ribosomal protein S20 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291419334|gb|EFE93053.1| ribosomal protein S20 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 116

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SAKK I   A+R+  NKS RS V+++++    A+  G  E A    + A+  I  
Sbjct: 30  MANIKSAKKRILVAAKRSERNKSIRSEVKTYIKKVYAAVEAGDKETAELMLKTAQKKICM 89

Query: 61  AKSKGIFHGNAASRKVSRLSK 81
           A+SKG+   N ASRKVS ++K
Sbjct: 90  ARSKGVLKANNASRKVSHIAK 110


>gi|222099704|ref|YP_002534272.1| 30S ribosomal protein S20 [Thermotoga neapolitana DSM 4359]
 gi|254813070|sp|B9K7H3|RS20_THENN RecName: Full=30S ribosomal protein S20
 gi|221572094|gb|ACM22906.1| 30S ribosomal protein S20 [Thermotoga neapolitana DSM 4359]
          Length = 99

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEAT-EACRKAESVIQ 59
          M N  SAKK +R   +R L NK+ ++  ++ ++   +AI  G+ +E   E  RKA++ I 
Sbjct: 1  MPNTKSAKKRVRVSEKRRLRNKAYKTFFKNRIKEVIKAIENGEPKEVVLELARKAQAAID 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          KA SKG+ H N  +R+  RL KR+   L S
Sbjct: 61 KAVSKGVIHKNQGARRKERLFKRVNEYLKS 90


>gi|297571557|ref|YP_003697331.1| ribosomal protein S20 [Arcanobacterium haemolyticum DSM 20595]
 gi|296931904|gb|ADH92712.1| ribosomal protein S20 [Arcanobacterium haemolyticum DSM 20595]
          Length = 88

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 48/80 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I+   +R + N++ +S +++ +R   EAI  G  E AT+A + A   + K
Sbjct: 1  MANIKSQKKRIKTNEKRRVRNQAYKSELKTLVRKTREAIATGDAEAATDALKVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKGI H N A+ + S+L+
Sbjct: 61 AVSKGIIHKNQAANRKSKLA 80


>gi|259236448|gb|ACW20345.1| ribosomal protein S20 [uncultured Helicobacter sp.]
          Length = 88

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKIKNIIKAVREAVAVNDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGILKKNTASRKVSRLNASVKKI 86


>gi|253988034|ref|YP_003039390.1| 30S ribosomal protein S20 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|253779484|emb|CAQ82645.1| 30s ribosomal protein s20 [Photorhabdus asymbiotica]
          Length = 87

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++  N AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKRRQHNASRRSMVRTFIKKVNAAIATGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L+ R+  +
Sbjct: 61 HACKGLIHKNKAARHKSNLTARINAM 86


>gi|32474592|ref|NP_867586.1| 30S ribosomal protein S20 [Rhodopirellula baltica SH 1]
 gi|59798846|sp|Q7UPC9|RS20_RHOBA RecName: Full=30S ribosomal protein S20
 gi|32445131|emb|CAD75133.1| probable 30S ribosomal protein S20 [Rhodopirellula baltica SH 1]
 gi|327541282|gb|EGF27825.1| 30S ribosomal protein S20 [Rhodopirellula baltica WH47]
          Length = 90

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +R+  +R L+N++ RS++RS +R   EA+    +E A    + A+  + +
Sbjct: 1  MPNTSSASKRLRQNEKRRLLNRATRSNMRSTIRRVREAVENNDLETAKNEFKVAQKKLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +  + H NAA+R  SRL+  +K    +A
Sbjct: 61 AAANNLIHKNAAARTKSRLNNLIKNAAQTA 90


>gi|77919017|ref|YP_356832.1| 30S ribosomal protein S20 [Pelobacter carbinolicus DSM 2380]
 gi|90111923|sp|Q3A4P5|RS20_PELCD RecName: Full=30S ribosomal protein S20
 gi|77545100|gb|ABA88662.1| SSU ribosomal protein S20P [Pelobacter carbinolicus DSM 2380]
          Length = 87

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+ A R   N   RS++RS ++    A   G  EEA  A  +A   I K
Sbjct: 1  MANHKSALKRNRQAAVRNARNTHIRSTMRSLVKMVRVAAASGNQEEAKTALDRAVPYIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H   ASRK+SRL K +  +
Sbjct: 61 AATKGVIHKATASRKISRLVKLVNTV 86


>gi|331003923|ref|ZP_08327412.1| 30S ribosomal protein S20 [Lachnospiraceae oral taxon 107 str.
          F0167]
 gi|330411943|gb|EGG91343.1| 30S ribosomal protein S20 [Lachnospiraceae oral taxon 107 str.
          F0167]
          Length = 88

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+    +T  NK+ RS V++ ++  + A+     + A +  + A   I K
Sbjct: 1  MANIKSAKKRIQVALVKTERNKAIRSKVKTAIKKVDSAVAANDKKLAQDNLKVAIVEITK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N ASRKV+RLSK +  I
Sbjct: 61 AASKGVYHKNNASRKVARLSKAVDSI 86


>gi|239941062|ref|ZP_04692999.1| 30S ribosomal protein S20 [Streptomyces roseosporus NRRL 15998]
 gi|239987542|ref|ZP_04708206.1| 30S ribosomal protein S20 [Streptomyces roseosporus NRRL 11379]
 gi|291444502|ref|ZP_06583892.1| predicted protein [Streptomyces roseosporus NRRL 15998]
 gi|291347449|gb|EFE74353.1| predicted protein [Streptomyces roseosporus NRRL 15998]
          Length = 88

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G +E+AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAAAAGDVEKATTAARDASRQLDKAVSKGVIHKNAAANKKSA 78

Query: 79 LSKRLKGI 86
          L+ ++  +
Sbjct: 79 LASKVAAL 86


>gi|315645947|ref|ZP_07899068.1| ribosomal protein S20 [Paenibacillus vortex V453]
 gi|315278708|gb|EFU42022.1| ribosomal protein S20 [Paenibacillus vortex V453]
          Length = 90

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 55/90 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++ A+ A+   +IE A  A + A   + K
Sbjct: 1  MPNIKSAIKRVKTSDKRHALNISQKSALRTAVKTADVALNGTEIEAAKAAFQAASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H NAA+RK SRL+KRL  +   A
Sbjct: 61 AVTKGLIHKNAAARKKSRLAKRLNALTAQA 90


>gi|322379190|ref|ZP_08053582.1| 30S ribosomal protein S20 [Helicobacter suis HS1]
 gi|322379996|ref|ZP_08054264.1| 30S ribosomal protein S20 [Helicobacter suis HS5]
 gi|321147585|gb|EFX42217.1| 30S ribosomal protein S20 [Helicobacter suis HS5]
 gi|321148392|gb|EFX42900.1| 30S ribosomal protein S20 [Helicobacter suis HS1]
          Length = 91

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++ ++   +A+    + +A EA + A   + K
Sbjct: 1  MANHKSAEKRIRQTTKRTERNRFYKTRIKNIVKAVRQAVEHNDLAKAQEAFKVANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+   N ASRKVSRL+  +K I
Sbjct: 61 FVSKGVLKKNTASRKVSRLNASVKKI 86


>gi|291541898|emb|CBL15008.1| SSU ribosomal protein S20P [Ruminococcus bromii L2-63]
          Length = 86

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK ++ IA +T  NK+ +S++R+ ++ A  A+     +  TEA R A   I +
Sbjct: 1  MPNIKSAKKRVKVIATKTARNKATKSALRTAVKKAYYAVDTN-ADNKTEAVRLAIKKIDQ 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KGI H N A+R  S L+KRL
Sbjct: 60 AAAKGILHKNTAARSKSSLAKRL 82


>gi|328882389|emb|CCA55628.1| SSU ribosomal protein S20p [Streptomyces venezuelae ATCC 10712]
          Length = 114

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%)

Query: 19  LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
           L NK+ +SS+++ +R A EA+  G +E+AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 45  LRNKAVKSSLKTAIRKAREAVAAGDVEKATVASRAASRALDKAVSKGVIHKNAAANKKSA 104

Query: 79  LSKRLKGI 86
           L+ ++  +
Sbjct: 105 LATKVAAL 112


>gi|313902203|ref|ZP_07835611.1| ribosomal protein S20 [Thermaerobacter subterraneus DSM 13965]
 gi|313467538|gb|EFR63044.1| ribosomal protein S20 [Thermaerobacter subterraneus DSM 13965]
          Length = 90

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA+K +R   R  L NK  ++ +++ +R   EA++ G  +    A R+A S I +
Sbjct: 1  MPNTRSARKRVRIAERNRLRNKMYKTRIKTAIRRLEEALSGGDDDAIRAALRRALSAIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  +G  H N A+RK SRL +RLK +
Sbjct: 61 AAVRGAIHRNTAARKKSRLMQRLKKL 86


>gi|126173295|ref|YP_001049444.1| 30S ribosomal protein S20 [Shewanella baltica OS155]
 gi|152999652|ref|YP_001365333.1| 30S ribosomal protein S20 [Shewanella baltica OS185]
 gi|160874272|ref|YP_001553588.1| 30S ribosomal protein S20 [Shewanella baltica OS195]
 gi|217974394|ref|YP_002359145.1| 30S ribosomal protein S20 [Shewanella baltica OS223]
 gi|304412573|ref|ZP_07394178.1| ribosomal protein S20 [Shewanella baltica OS183]
 gi|307303589|ref|ZP_07583342.1| ribosomal protein S20 [Shewanella baltica BA175]
 gi|166223984|sp|A3D1G2|RS20_SHEB5 RecName: Full=30S ribosomal protein S20
 gi|166223985|sp|A6WKD1|RS20_SHEB8 RecName: Full=30S ribosomal protein S20
 gi|189044882|sp|A9L4U3|RS20_SHEB9 RecName: Full=30S ribosomal protein S20
 gi|254813062|sp|B8EFD0|RS20_SHEB2 RecName: Full=30S ribosomal protein S20
 gi|125996500|gb|ABN60575.1| SSU ribosomal protein S20P [Shewanella baltica OS155]
 gi|151364270|gb|ABS07270.1| ribosomal protein S20 [Shewanella baltica OS185]
 gi|160859794|gb|ABX48328.1| ribosomal protein S20 [Shewanella baltica OS195]
 gi|217499529|gb|ACK47722.1| ribosomal protein S20 [Shewanella baltica OS223]
 gi|304349049|gb|EFM13462.1| ribosomal protein S20 [Shewanella baltica OS183]
 gi|306912487|gb|EFN42910.1| ribosomal protein S20 [Shewanella baltica BA175]
 gi|315266506|gb|ADT93359.1| ribosomal protein S20 [Shewanella baltica OS678]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    AI  G  + A EA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIKAGDHKTAAEAFAVAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ ++K I
Sbjct: 61 MATKGLIHKNKAARQKARLNAKIKAI 86


>gi|146305985|ref|YP_001186450.1| 30S ribosomal protein S20 [Pseudomonas mendocina ymp]
 gi|330501952|ref|YP_004378821.1| 30S ribosomal protein S20 [Pseudomonas mendocina NK-01]
 gi|166223971|sp|A4XQV2|RS20_PSEMY RecName: Full=30S ribosomal protein S20
 gi|145574186|gb|ABP83718.1| SSU ribosomal protein S20P [Pseudomonas mendocina ymp]
 gi|328916238|gb|AEB57069.1| 30S ribosomal protein S20 [Pseudomonas mendocina NK-01]
          Length = 92

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI    +E A  A   A  VI +
Sbjct: 1  MANSPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIAAKDLELAKTAYTAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+  +K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAHIKAL 86


>gi|90412463|ref|ZP_01220466.1| putative ribosomal protein S20 [Photobacterium profundum 3TCK]
 gi|90326500|gb|EAS42906.1| putative ribosomal protein S20 [Photobacterium profundum 3TCK]
          Length = 86

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G+ E AT+A  + + V+ +
Sbjct: 1  MANIKSAKKRAITSEKRRQHNASRRSMMRTFFKKVIAAIEAGEKENATKAFAEMQPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ ++K +
Sbjct: 61 MSTKGLIHKNKAARQKARLTAKIKAL 86


>gi|226953070|ref|ZP_03823534.1| 30S ribosomal protein S20 [Acinetobacter sp. ATCC 27244]
 gi|262372272|ref|ZP_06065551.1| ribosomal protein S20 [Acinetobacter junii SH205]
 gi|294650659|ref|ZP_06728013.1| 30S ribosomal protein S20 [Acinetobacter haemolyticus ATCC 19194]
 gi|226836162|gb|EEH68545.1| 30S ribosomal protein S20 [Acinetobacter sp. ATCC 27244]
 gi|262312297|gb|EEY93382.1| ribosomal protein S20 [Acinetobacter junii SH205]
 gi|292823450|gb|EFF82299.1| 30S ribosomal protein S20 [Acinetobacter haemolyticus ATCC 19194]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI  G    A+EA + A  VI +
Sbjct: 1  MANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTVNAIAAGDYAVASEAYKTAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQIKAL 86


>gi|154248825|ref|YP_001409650.1| 30S ribosomal protein S20 [Fervidobacterium nodosum Rt17-B1]
 gi|171769317|sp|A7HJB0|RS20_FERNB RecName: Full=30S ribosomal protein S20
 gi|154152761|gb|ABS59993.1| ribosomal protein S20 [Fervidobacterium nodosum Rt17-B1]
          Length = 95

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGK-IEEATEACRKAESVIQ 59
          M NK SA+K +R   +R ++NK+ ++S+++ ++    AI   K  EE  E  RKA+S I 
Sbjct: 1  MPNKMSAEKRVRVSEKRRVLNKAYKTSMKNKIKAVLAAIAQKKSAEEIMELFRKAQSAID 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          KA   G  H N ASR+ SRL+ ++K  L
Sbjct: 61 KAAKSGAIHKNQASRRKSRLAVKVKAYL 88


>gi|297194434|ref|ZP_06911832.1| 30S ribosomal protein S20 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|197718757|gb|EDY62665.1| 30S ribosomal protein S20 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA+  G +E AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAVAAGDVESATVAARAASRQLDKAVSKGVIHKNAAANKKSA 78

Query: 79 LSKRL 83
          L+ ++
Sbjct: 79 LAAKV 83


>gi|188585802|ref|YP_001917347.1| SSU ribosomal protein S20P [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|226736527|sp|B2A1L9|RS20_NATTJ RecName: Full=30S ribosomal protein S20
 gi|179350489|gb|ACB84759.1| SSU ribosomal protein S20P [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK +R   ++TL NK  ++ V++ ++    A+    +E A E  + A   I K
Sbjct: 1  MPNIKSAKKRVRVTRKKTLRNKHVKTMVKTAIKKFELALQNEDVETAREELKNATKTIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK SRL+ +   I
Sbjct: 61 AVSKGVIHKNNAARKKSRLTAKFNNI 86


>gi|160872516|ref|ZP_02062648.1| ribosomal protein S20 [Rickettsiella grylli]
 gi|159121315|gb|EDP46653.1| ribosomal protein S20 [Rickettsiella grylli]
          Length = 94

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN   AKK IR+  +R   N S RS +R++++    AI  G+  +A +A + A  +I +
Sbjct: 3  LANTKQAKKRIRQAEKRRKHNSSYRSMMRTYIKRVVVAIEAGEATKAKDAYQTALPIIDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +KG  H N A+R  SRLS R+  I  +A
Sbjct: 63 MANKGFIHKNKAARHKSRLSARILQIENTA 92


>gi|322421077|ref|YP_004200300.1| 30S ribosomal protein S20 [Geobacter sp. M18]
 gi|320127464|gb|ADW15024.1| ribosomal protein S20 [Geobacter sp. M18]
          Length = 87

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I++  +RT  NK  RS++R+F++   EA+       A  A   A  VI  
Sbjct: 1  MANHKSAIKRIKQTEKRTERNKHERSTLRTFIKRVREAVATKDQVAAKAALAAAIPVIDG 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KGI H + ASR VSRL+K
Sbjct: 61 AATKGIIHSSNASRNVSRLTK 81


>gi|227874465|ref|ZP_03992641.1| ribosomal protein S20 [Oribacterium sinus F0268]
 gi|227839693|gb|EEJ50147.1| ribosomal protein S20 [Oribacterium sinus F0268]
          Length = 94

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 47/79 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+  A+R   NK+ RS V+++M+    A+  G    A     KA+  I  
Sbjct: 8  MANIKSAKKRIQVAAQRNERNKAIRSEVKTYMKKVFTAVEAGDKATAETMLVKAQKKIAM 67

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A+SKGI+  N ASRK+S++
Sbjct: 68 ARSKGIYKANNASRKISQI 86


>gi|256545390|ref|ZP_05472753.1| 30S ribosomal protein S20 [Anaerococcus vaginalis ATCC 51170]
 gi|256398951|gb|EEU12565.1| 30S ribosomal protein S20 [Anaerococcus vaginalis ATCC 51170]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I    ++T  NKS +S ++++++   EAI     E+A E  +  +  +++
Sbjct: 1  MANIKSAIKRIDVTRKQTARNKSAKSEIKTYVKKFEEAIANNDSEKANELFKTVDKKVKQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +K I H N ASR  SRL+K+L  +
Sbjct: 61 AAAKNIIHKNQASRTTSRLAKKLNSL 86


>gi|320540432|ref|ZP_08040082.1| 30S ribosomal subunit protein S20 [Serratia symbiotica str.
          Tucson]
 gi|320029363|gb|EFW11392.1| 30S ribosomal subunit protein S20 [Serratia symbiotica str.
          Tucson]
          Length = 87

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++  + AI  G  E A  A    + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKRRKHNASRRSMVRTFIKKVDAAIAAGDKEAAQNAFSVMQPLVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+FH N A+R  S L+ R+  +
Sbjct: 61 QAAKGLFHKNKAARHKSNLTARINAM 86


>gi|103488663|ref|YP_618224.1| 30S ribosomal protein S20 [Sphingopyxis alaskensis RB2256]
 gi|118573844|sp|Q1GN81|RS20_SPHAL RecName: Full=30S ribosomal protein S20
 gi|98978740|gb|ABF54891.1| SSU ribosomal protein S20P [Sphingopyxis alaskensis RB2256]
          Length = 87

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+   R ++NK+R S +R+ ++    A+  G  + A  A + A+  + +
Sbjct: 1  MANTPQAKKRIRRNQARAVVNKNRVSRIRTLVKKVEAAVAAGDKDAAATALKAAQPEMAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N  +RK SRL+K +  I
Sbjct: 61 GVAKGVLHKNTVARKYSRLTKSVNAI 86


>gi|308177473|ref|YP_003916879.1| 30S ribosomal protein S20 [Arthrobacter arilaitensis Re117]
 gi|307744936|emb|CBT75908.1| 30S ribosomal protein S20 [Arthrobacter arilaitensis Re117]
          Length = 86

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK      +  L N + RS V++ +R+ NEA+  G  E+ATEA R A   + K
Sbjct: 1  MANIKSQKKRNLTNEKARLRNVAVRSEVKTVIRNVNEAVVSGDKEKATEALRLAGKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S ++K++  +
Sbjct: 61 AVSKGVLHKNNAANRKSAIAKKVNAL 86


>gi|254392602|ref|ZP_05007779.1| 30S ribosomal protein S20 [Streptomyces clavuligerus ATCC 27064]
 gi|294812568|ref|ZP_06771211.1| 30S ribosomal protein S20 [Streptomyces clavuligerus ATCC 27064]
 gi|326440979|ref|ZP_08215713.1| 30S ribosomal protein S20 [Streptomyces clavuligerus ATCC 27064]
 gi|197706266|gb|EDY52078.1| 30S ribosomal protein S20 [Streptomyces clavuligerus ATCC 27064]
 gi|294325167|gb|EFG06810.1| 30S ribosomal protein S20 [Streptomyces clavuligerus ATCC 27064]
          Length = 88

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (67%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA+  G +E+AT A R+A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKAVKSSLKTAVRKAREAVASGDLEKATVAAREAARKLDKAVSKGVIHKNAAANKKSA 78

Query: 79 LSKRL 83
          L+ ++
Sbjct: 79 LASKV 83


>gi|260654884|ref|ZP_05860372.1| ribosomal protein S20 [Jonquetella anthropi E3_33 E1]
 gi|260630386|gb|EEX48580.1| ribosomal protein S20 [Jonquetella anthropi E3_33 E1]
          Length = 88

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SA + +R   R  L N+  +S  ++ ++   E++  G  E A +    A+SV+ K
Sbjct: 1  MPNKKSAIRRVRTSERNRLYNRYWKSRCKTAVKRVLESVAAGDSELAVKRLDAAQSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N A+R+ SRLS ++K +
Sbjct: 61 AVVKGVIHKNTAARRKSRLSNKVKSL 86


>gi|326201857|ref|ZP_08191727.1| ribosomal protein S20 [Clostridium papyrosolvens DSM 2782]
 gi|325987652|gb|EGD48478.1| ribosomal protein S20 [Clostridium papyrosolvens DSM 2782]
          Length = 85

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++ I  +TL N  R+S++++ ++   EAI  G  E  T+A + A   + K
Sbjct: 1  MPNIKSAIKRVKVIETKTLKNTIRKSALKTTVKKCKEAIATG--ENKTDAYKAATKALDK 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +K + H N A+RK SRL+K L
Sbjct: 59 AAAKNLMHKNTAARKKSRLAKAL 81


>gi|15894556|ref|NP_347905.1| 30S ribosomal protein S20 [Clostridium acetobutylicum ATCC 824]
 gi|17865581|sp|Q97JK0|RS20_CLOAB RecName: Full=30S ribosomal protein S20
 gi|15024201|gb|AAK79245.1|AE007639_18 Ribosomal protein S20 [Clostridium acetobutylicum ATCC 824]
 gi|325508688|gb|ADZ20324.1| 30S ribosomal protein S20 [Clostridium acetobutylicum EA 2018]
          Length = 88

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +S+++++++    A     +EE+  A       +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMIKSALKTYIKKFEAAFEAKNVEESKTAFATVSKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGI H N A+RK SRL+ +L  +
Sbjct: 61 AASKGIIHKNKAARKKSRLALKLNSL 86


>gi|212636477|ref|YP_002313002.1| 30S ribosomal protein S20 [Shewanella piezotolerans WP3]
 gi|226695419|sp|B8CSC5|RS20_SHEPW RecName: Full=30S ribosomal protein S20
 gi|212557961|gb|ACJ30415.1| Ribosomal protein S20 [Shewanella piezotolerans WP3]
          Length = 88

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SR S +R++++    AI  G  E AT A   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRSSMLRTYVKKVIAAINAGDHESATAAFVTAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 MATKGLIHKNKAARYKSRLNAKIKAL 86


>gi|169334768|ref|ZP_02861961.1| hypothetical protein ANASTE_01174 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169257506|gb|EDS71472.1| hypothetical protein ANASTE_01174 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 87

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +  L NK+ ++++++  +  ++AI    +E+A EAC+ A      
Sbjct: 1  MANIKSAKKRAITNEKSRLRNKAIKTNLKTAQKEFDQAILSNDVEKAQEACKVASKKFDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGI H NAA RK ++L+K++  +
Sbjct: 61 AASKGIIHKNAADRKKAQLAKKVNAL 86


>gi|254456423|ref|ZP_05069852.1| ribosomal protein S20 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083425|gb|EDZ60851.1| ribosomal protein S20 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 86

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K IR+I+++T +NK R+S  R+ ++  N  I   K +EA +   K  S + K
Sbjct: 1  MANTKSAIKRIRRISKQTAVNKVRKSRFRNALKKMNLLIEDKKKDEALKFLPKLNSELMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
              GI     ASR VSR++K++  I
Sbjct: 61 IAKTGIIKKQNASRNVSRITKKISAI 86


>gi|239814461|ref|YP_002943371.1| 30S ribosomal protein S20 [Variovorax paradoxus S110]
 gi|319792290|ref|YP_004153930.1| ribosomal protein s20 [Variovorax paradoxus EPS]
 gi|259494877|sp|C5CSK7|RS20_VARPS RecName: Full=30S ribosomal protein S20
 gi|239801038|gb|ACS18105.1| ribosomal protein S20 [Variovorax paradoxus S110]
 gi|315594753|gb|ADU35819.1| ribosomal protein S20 [Variovorax paradoxus EPS]
          Length = 104

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G   +A+E   KA+S++     KG
Sbjct: 15 SGRKRVRQDTKLNAANTSLRSKYRTAVKNVEKAVLAGDKTKASELFAKAQSIVDTVADKG 74

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          IFH N A+R  SRLS ++K +
Sbjct: 75 IFHKNKAARDKSRLSAKVKAL 95


>gi|59798726|sp|Q6LUL5|RS20_PHOPR RecName: Full=30S ribosomal protein S20
          Length = 86

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G+ E AT+A    + V+ +
Sbjct: 1  MANIKSAKKRAITSEKRRQHNASRRSMMRTFFKKVIAAIEAGEKENATKAFADMQPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARQKARLTAKIKAL 86


>gi|262370243|ref|ZP_06063569.1| ribosomal protein S20 [Acinetobacter johnsonii SH046]
 gi|262314585|gb|EEY95626.1| ribosomal protein S20 [Acinetobacter johnsonii SH046]
          Length = 88

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI  G    A+EA + A  VI +
Sbjct: 1  MANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTVAAIAAGDYAVASEAYKTAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|254429490|ref|ZP_05043197.1| ribosomal protein S20 [Alcanivorax sp. DG881]
 gi|196195659|gb|EDX90618.1| ribosomal protein S20 [Alcanivorax sp. DG881]
          Length = 65

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 38/62 (61%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
          RS VR++++  N AI  G    A EA  +A SV+ KA  KG FH N A+R  SRL+ ++K
Sbjct: 2  RSMVRTYLKKVNAAIASGDQGSAQEAYNQAVSVLDKATRKGKFHPNKAARHKSRLNTKIK 61

Query: 85 GI 86
           +
Sbjct: 62 AM 63


>gi|89072551|ref|ZP_01159123.1| putative ribosomal protein S20 [Photobacterium sp. SKA34]
 gi|89051655|gb|EAR57108.1| putative ribosomal protein S20 [Photobacterium sp. SKA34]
          Length = 86

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G  E AT+A  + + V+ +
Sbjct: 1  MANIKSAKKRALTSEKRRQHNASRRSMMRTFFKKVITAIEAGNKEAATQAFAEMQPVMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKARLTAKIKAL 86


>gi|293115616|ref|ZP_05792350.2| ribosomal protein S20 [Butyrivibrio crossotus DSM 2876]
 gi|292809123|gb|EFF68328.1| ribosomal protein S20 [Butyrivibrio crossotus DSM 2876]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NKS RS+++++ +    A+     E A  A + A + I K
Sbjct: 6  LANIKSAKKRILVNETKAERNKSIRSAIKTYTKKVEAAVEANDKEAAASALKVASTEIDK 65

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG+FH N A+RK+SRL+
Sbjct: 66 ACSKGVFHKNNAARKISRLT 85


>gi|326386026|ref|ZP_08207650.1| formamidopyrimidine-DNA glycosylase, putative [Novosphingobium
          nitrogenifigens DSM 19370]
 gi|326209251|gb|EGD60044.1| formamidopyrimidine-DNA glycosylase, putative [Novosphingobium
          nitrogenifigens DSM 19370]
          Length = 86

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K IR+  RR  IN +R S +R+F++    AI  G    A++A + A+  + +
Sbjct: 1  MANTPQARKRIRRNERRAEINGARLSRIRTFVKKVETAIAGGDKTIASDALKAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+RK+SRL+KR+  +
Sbjct: 61 GVARGVLHKNTAARKLSRLTKRVAAL 86


>gi|260893424|ref|YP_003239521.1| ribosomal protein S20 [Ammonifex degensii KC4]
 gi|260865565|gb|ACX52671.1| ribosomal protein S20 [Ammonifex degensii KC4]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA K S K+ +R+I +RTL NK  RS++++ ++   +A+  G   +  E  R A   I K
Sbjct: 1  MAKKSSLKR-LRQIRKRTLRNKMLRSALKTAIKKFEQALAQG-APDVEEKLRAALRAIDK 58

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A++KGI H N A+RK SRL
Sbjct: 59 ARTKGILHRNTAARKKSRL 77


>gi|166030885|ref|ZP_02233714.1| hypothetical protein DORFOR_00565 [Dorea formicigenerans ATCC
          27755]
 gi|166029152|gb|EDR47909.1| hypothetical protein DORFOR_00565 [Dorea formicigenerans ATCC
          27755]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NK+ +S V+++++    A+       A  A ++A + I K
Sbjct: 6  LANIKSAKKRILVNETKAARNKAIKSKVKTYVKKVETAVEKKDAATAAVALKEAIAEINK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N  SRK+SRL+K + GI
Sbjct: 66 AGSKGVYHKNTCSRKISRLTKAVNGI 91


>gi|229588311|ref|YP_002870430.1| 30S ribosomal protein S20 [Pseudomonas fluorescens SBW25]
 gi|259494871|sp|C3KDX1|RS20_PSEFS RecName: Full=30S ribosomal protein S20
 gi|229360177|emb|CAY47034.1| 30S ribosomal protein S20 [Pseudomonas fluorescens SBW25]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 49/90 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDTKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRL+  +K +   A
Sbjct: 61 MADKGIIHKNKAARHKSRLNGHIKALSVPA 90


>gi|317133551|ref|YP_004092865.1| ribosomal protein S20 [Ethanoligenens harbinense YUAN-3]
 gi|315471530|gb|ADU28134.1| ribosomal protein S20 [Ethanoligenens harbinense YUAN-3]
          Length = 86

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK ++  A +TL NK+ +S++R+ ++ A  A++ G  E   +A + A   I K
Sbjct: 1  MPNIKSAKKRVKVTAVKTLRNKAYKSALRTSIKKAQSAVSDG-AENKADAFKAAVVKIDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKGI H N A+ K S+L+K
Sbjct: 60 AVSKGILHKNTAAHKKSKLAK 80


>gi|294010808|ref|YP_003544268.1| ribosomal protein S20 [Sphingobium japonicum UT26S]
 gi|292674138|dbj|BAI95656.1| ribosomal protein S20 [Sphingobium japonicum UT26S]
          Length = 87

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK IR+ ARR  IN +R S +R+ ++    A+  G    AT A +  +  + +
Sbjct: 1  MANTPQAKKRIRRNARRAEINGARISRIRTLVKKVETALAAGDKAAATTALQSVQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+RK  RL+KR+  +
Sbjct: 61 GVARGVLHKNTAARKFGRLTKRVSAL 86


>gi|304413763|ref|ZP_07395207.1| 30S ribosomal subunit protein S20 [Candidatus Regiella
          insecticola LSR1]
 gi|304283854|gb|EFL92248.1| 30S ribosomal subunit protein S20 [Candidatus Regiella
          insecticola LSR1]
          Length = 87

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+F++   +AI+ G  ++A +A  + + VI +
Sbjct: 1  MANIKSAKKRAKQSEKRRQHNASCRSMVRTFIKKVYQAISTGDKDKAQKAFNEMQPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
             KG+ H N A+R  S L+K++
Sbjct: 61 KSCKGLIHKNKAARHKSNLAKQI 83


>gi|53803711|ref|YP_114668.1| 30S ribosomal protein S20 [Methylococcus capsulatus str. Bath]
 gi|59798626|sp|Q605N0|RS20_METCA RecName: Full=30S ribosomal protein S20
 gi|53757472|gb|AAU91763.1| ribosomal protein S20 [Methylococcus capsulatus str. Bath]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+       N + RS +R++++    A+  G + +A EA R+A  +I  
Sbjct: 1  MANIASAKKRARQAENNRAHNAALRSRLRTYIKKVILAVDSGDLTKAQEAFRQAVPIIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          + +KG+ H N A+R  SRL+ R+K +   A
Sbjct: 61 SVNKGLIHRNKAARSKSRLNARVKALALQA 90


>gi|118444762|ref|YP_878574.1| 30S ribosomal protein S20 [Clostridium novyi NT]
 gi|166223930|sp|A0Q1S2|RS20_CLONN RecName: Full=30S ribosomal protein S20
 gi|118135218|gb|ABK62262.1| ribosomal protein S20 [Clostridium novyi NT]
          Length = 88

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +S++++ +++   A+    + EA  A       +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMIKSALKTKIKNFEVAVANNDLNEAKSAYTIVVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+RK SRL+ +L G+
Sbjct: 61 AAAKGILHKNKAARKKSRLATKLSGL 86


>gi|312958879|ref|ZP_07773398.1| 30S ribosomal protein S20 [Pseudomonas fluorescens WH6]
 gi|311286649|gb|EFQ65211.1| 30S ribosomal protein S20 [Pseudomonas fluorescens WH6]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDTKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRL+  +K +  +A
Sbjct: 61 MADKGIIHKNKAARHKSRLNGHIKALNVAA 90


>gi|34557215|ref|NP_907030.1| 30S ribosomal protein S20 [Wolinella succinogenes DSM 1740]
 gi|59798811|sp|Q7M9M3|RS20_WOLSU RecName: Full=30S ribosomal protein S20
 gi|34482931|emb|CAE09930.1| 30S RIBOSOMAL PROTEIN S20 [Wolinella succinogenes]
          Length = 91

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  R+ +++  +   EA+      +A EA + A   + K
Sbjct: 1  MANHKSAEKRIRQTLKRTERNRYYRTRIKNITKAVKEAVASNDATKAEEALKVANKDLHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N A+RKVSRL   +K +
Sbjct: 61 FVSKGILPKNTAARKVSRLHASVKKL 86


>gi|330447399|ref|ZP_08311048.1| ribosomal protein S20 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|328491590|dbj|GAA05545.1| ribosomal protein S20 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 86

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G  E AT+A  + + V+ +
Sbjct: 1  MANIKSAKKRALTSEKRRQHNASRRSMMRTFFKKVIAAIEAGNKEAATQAFAEMQPVMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKARLAAKIKAL 86


>gi|94985532|ref|YP_604896.1| 30S ribosomal protein S20 [Deinococcus geothermalis DSM 11300]
 gi|118573816|sp|Q1IYF7|RS20_DEIGD RecName: Full=30S ribosomal protein S20
 gi|94555813|gb|ABF45727.1| ribosomal protein S20 [Deinococcus geothermalis DSM 11300]
          Length = 95

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K  R+  +R LIN+SR++++++F + A  A   G  E A E  RKAES+I KA    
Sbjct: 7  SAQKRHRQSLKRRLINRSRKNTIKTFSKKAVVAAQNG-AENAVELHRKAESLIDKAAKGS 65

Query: 66 IFHGNAASRKVSR 78
            H NAA+RK SR
Sbjct: 66 TLHKNAAARKKSR 78


>gi|72161231|ref|YP_288888.1| 30S ribosomal protein S20P [Thermobifida fusca YX]
 gi|118574567|sp|Q47RQ2|RS20_THEFY RecName: Full=30S ribosomal protein S20
 gi|71914963|gb|AAZ54865.1| SSU ribosomal protein S20P [Thermobifida fusca YX]
          Length = 92

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK IR+  +  L NK+ +SS+++ +R   EA   G +EEA    R A   + K
Sbjct: 1  MANIKSQKKRIRQNEKARLRNKAVKSSLKTAIRKFREAAEAGNVEEAIILQRAAARQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H N A+ + S ++KRL  +  S
Sbjct: 61 AVSKGVIHKNQAANRKSAIAKRLHQLQQS 89


>gi|159039375|ref|YP_001538628.1| ribosomal protein S20 [Salinispora arenicola CNS-205]
 gi|189044879|sp|A8M0X6|RS20_SALAI RecName: Full=30S ribosomal protein S20
 gi|157918210|gb|ABV99637.1| ribosomal protein S20 [Salinispora arenicola CNS-205]
          Length = 88

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 51/83 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +R L NKS +SS+++ +R  +EA   G +E+AT   R+A   + K
Sbjct: 1  MANIKSQIKRNRQNEKRRLRNKSVKSSLKTAIRKFHEAAETGDVEKATVLMREAARKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S ++KR+
Sbjct: 61 AASKGVIHANQAANRKSAIAKRV 83


>gi|330811823|ref|YP_004356285.1| 30S ribosomal protein S20 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327379931|gb|AEA71281.1| 30S ribosomal protein S20 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 92

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRL+  +K +  +A
Sbjct: 61 MADKGIIHKNKAARHKSRLNGHVKALNVAA 90


>gi|239931348|ref|ZP_04688301.1| 30S ribosomal protein S20 [Streptomyces ghanaensis ATCC 14672]
 gi|291439722|ref|ZP_06579112.1| 30S ribosomal protein S20 [Streptomyces ghanaensis ATCC 14672]
 gi|291342617|gb|EFE69573.1| 30S ribosomal protein S20 [Streptomyces ghanaensis ATCC 14672]
          Length = 88

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA+  G +E+ATE  R A   + KA SKG+ H N A+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAVAAGDVEKATEYQRVAARQLDKAVSKGVIHKNQAANKKSA 78

Query: 79 LSKRLKGI 86
          L++++  I
Sbjct: 79 LAQKVATI 86


>gi|30250267|ref|NP_842337.1| ribosomal protein S20 [Nitrosomonas europaea ATCC 19718]
 gi|59798882|sp|Q82SI6|RS20_NITEU RecName: Full=30S ribosomal protein S20
 gi|30181062|emb|CAD86252.1| Ribosomal protein S20 [Nitrosomonas europaea ATCC 19718]
          Length = 87

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK +R+ A R   N   RS +R+ ++   +A+  G    A    RKA SVI  
Sbjct: 1  MANTAQAKKRVRQTATRRERNFGLRSKLRTAIKGVRKAVAAGDKNVAEVVFRKAVSVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI H N ASR  SRLS  +K +
Sbjct: 61 VASKGIIHKNKASRHKSRLSGAVKAM 86


>gi|58040923|ref|YP_192887.1| 30S ribosomal protein S20 [Gluconobacter oxydans 621H]
 gi|62510967|sp|Q5FN16|RS20_GLUOX RecName: Full=30S ribosomal protein S20
 gi|58003337|gb|AAW62231.1| SSU ribosomal protein S20P [Gluconobacter oxydans 621H]
          Length = 89

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 53/89 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  RR   N +R S +R+F++    AI  G    A EA + A+  +Q+
Sbjct: 1  MANTASARKRIRQNERRRERNVARMSRMRTFIKKVELAIQAGDKSAAAEAFKVAQPEMQR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A  KG+   N  SRK+SRLS R+K + T+
Sbjct: 61 AAGKGVIAKNTISRKLSRLSARVKALATA 89


>gi|54307792|ref|YP_128812.1| putative ribosomal protein S20 [Photobacterium profundum SS9]
 gi|46912215|emb|CAG19010.1| putative ribosomal protein S20 [Photobacterium profundum SS9]
          Length = 97

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK      +R   N SRRS +R+F +    AI  G+ E AT+A    + V+ +
Sbjct: 12 LANIKSAKKRAITSEKRRQHNASRRSMMRTFFKKVIAAIEAGEKENATKAFADMQPVLDR 71

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ ++K +
Sbjct: 72 MATKGLIHKNKAARQKARLTAKIKAL 97


>gi|121605900|ref|YP_983229.1| 30S ribosomal protein S20 [Polaromonas naphthalenivorans CJ2]
 gi|166223964|sp|A1VRN0|RS20_POLNA RecName: Full=30S ribosomal protein S20
 gi|120594869|gb|ABM38308.1| SSU ribosomal protein S20P [Polaromonas naphthalenivorans CJ2]
          Length = 106

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G  ++A +   KA+S++     KG
Sbjct: 15 SGRKRVRQDVKLNAANTSLRSKYRTAVKNVEKAVLAGDKDKAKDLFAKAQSIVDTISDKG 74

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          IFH N A+R  SRLS ++K +
Sbjct: 75 IFHKNKAARDKSRLSAKVKAL 95


>gi|52842842|ref|YP_096641.1| 30S ribosomal protein S20 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54295475|ref|YP_127890.1| 30S ribosomal protein S20 [Legionella pneumophila str. Lens]
 gi|54298625|ref|YP_124994.1| 30S ribosomal protein S20 [Legionella pneumophila str. Paris]
 gi|148358629|ref|YP_001249836.1| 30S ribosomal protein S20 [Legionella pneumophila str. Corby]
 gi|296108281|ref|YP_003619982.1| small subunit ribosomal protein S20 [Legionella pneumophila
          2300/99 Alcoy]
 gi|62511001|sp|Q5WTG3|RS20_LEGPL RecName: Full=30S ribosomal protein S20
 gi|62511002|sp|Q5X1Q4|RS20_LEGPA RecName: Full=30S ribosomal protein S20
 gi|62511004|sp|Q5ZS83|RS20_LEGPH RecName: Full=30S ribosomal protein S20
 gi|166223944|sp|A5IAU0|RS20_LEGPC RecName: Full=30S ribosomal protein S20
 gi|52629953|gb|AAU28694.1| 30S ribosomal protein S20 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|53752410|emb|CAH13842.1| 30S ribosomal subunit protein S20 [Legionella pneumophila str.
          Paris]
 gi|53755307|emb|CAH16801.1| 30S ribosomal subunit protein S20 [Legionella pneumophila str.
          Lens]
 gi|148280402|gb|ABQ54490.1| 30S ribosomal protein S20 [Legionella pneumophila str. Corby]
 gi|295650183|gb|ADG26030.1| small subunit ribosomal protein S20 [Legionella pneumophila
          2300/99 Alcoy]
 gi|307611513|emb|CBX01187.1| 30S ribosomal subunit protein S20 [Legionella pneumophila 130b]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +    N S RS  R+++++  +A+  G  E A  A  KA+ VI K
Sbjct: 1  MANIKSAIKRARQNVKLRQHNASARSMYRTYIKNVLKAVESGDQEAARAAYTKAQPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N A+R   RL  RLK +
Sbjct: 61 AANKGLIHKNKAARIKGRLVARLKAM 86


>gi|77461076|ref|YP_350583.1| 30S ribosomal protein S20 [Pseudomonas fluorescens Pf0-1]
 gi|115305702|sp|Q3K6L2|RS20_PSEPF RecName: Full=30S ribosomal protein S20
 gi|77385079|gb|ABA76592.1| 30S ribosomal protein S20 [Pseudomonas fluorescens Pf0-1]
          Length = 90

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANSPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRL+  +K +  +A
Sbjct: 61 MADKGIIHKNKAARHKSRLNGHVKALKAAA 90


>gi|168181653|ref|ZP_02616317.1| 30S ribosomal protein S20 [Clostridium botulinum Bf]
 gi|237796420|ref|YP_002863972.1| 30S ribosomal protein S20 [Clostridium botulinum Ba4 str. 657]
 gi|259494855|sp|C3L3H5|RS20_CLOB6 RecName: Full=30S ribosomal protein S20
 gi|182675012|gb|EDT86973.1| 30S ribosomal protein S20 [Clostridium botulinum Bf]
 gi|229262076|gb|ACQ53109.1| 30S ribosomal protein S20 [Clostridium botulinum Ba4 str. 657]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +SS+++ +++    +    +EEA  A + A   +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMLKSSLKTTIKNFLTVVEGKNVEEAKAAYKTAARALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKGI H N A+R  SRL+ +L  +
Sbjct: 61 SVSKGIIHKNKAARTKSRLAAKLNAL 86


>gi|220932125|ref|YP_002509033.1| ribosomal protein S20 [Halothermothrix orenii H 168]
 gi|254813099|sp|B8CXL9|RS20_HALOH RecName: Full=30S ribosomal protein S20
 gi|219993435|gb|ACL70038.1| ribosomal protein S20 [Halothermothrix orenii H 168]
          Length = 87

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SAKK +R   +RT  N+  +  ++  ++   + +  G +EEA    R+A  ++ K+  KG
Sbjct: 6  SAKKRVRITEKRTAYNREWKEKIKQAIKEFEKVVEEGNVEEAEAKLREASKILDKSAGKG 65

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          I H N A+RK S+L+++   I
Sbjct: 66 IIHKNKAARKKSQLTRQFNKI 86


>gi|254457510|ref|ZP_05070938.1| ribosomal protein S20 [Campylobacterales bacterium GD 1]
 gi|207086302|gb|EDZ63586.1| ribosomal protein S20 [Campylobacterales bacterium GD 1]
          Length = 86

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K IR+   RT  N+  R+ +++ ++  N A+  G  EEA  A + A   I K
Sbjct: 1  MANHKSSIKRIRQTIVRTERNRFYRTRLKNIVKGVNSAVEAGNKEEAAAALKVANKQIHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI     A+RKVSRL K +  I
Sbjct: 61 FVSKGILKKETAARKVSRLHKSVNAI 86


>gi|145595977|ref|YP_001160274.1| ribosomal protein S20 [Salinispora tropica CNB-440]
 gi|189044881|sp|A4XAE7|RS20_SALTO RecName: Full=30S ribosomal protein S20
 gi|145305314|gb|ABP55896.1| SSU ribosomal protein S20P [Salinispora tropica CNB-440]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +R L NKS +SS+++ +R  +EA   G +E+AT   R A   + K
Sbjct: 1  MANIKSQIKRNRQNEKRRLRNKSVKSSLKTAIRKFHEAAETGDVEKATVLMRDAARKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S ++KR+
Sbjct: 61 AASKGVIHANQAANRKSAIAKRV 83


>gi|269103426|ref|ZP_06156123.1| SSU ribosomal protein S20p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|268163324|gb|EEZ41820.1| SSU ribosomal protein S20p [Photobacterium damselae subsp.
          damselae CIP 102761]
          Length = 86

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G  E AT+A  + + V+ +
Sbjct: 1  MANIKSAKKRALTSEKRRKHNASRRSMMRTFFKKVVAAIEAGNKEAATQAFVEMQPVMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKARLAAKIKAL 86


>gi|329121902|ref|ZP_08250516.1| trigger factor [Dialister micraerophilus DSM 19965]
 gi|327467699|gb|EGF13195.1| trigger factor [Dialister micraerophilus DSM 19965]
          Length = 85

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA   ++ K IRK  + T  N S +S +R+ ++   +AI     E+ TE+ R A SVI  
Sbjct: 1  MAQIKASIKSIRKDIKITAANASVKSEIRTAVK---KAIAAAGTEQETESLRSAISVIDS 57

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A+ KGI H N A+RK SRL+ R+K 
Sbjct: 58 AERKGIIHKNNAARKKSRLNARIKA 82


>gi|225378292|ref|ZP_03755513.1| hypothetical protein ROSEINA2194_03953 [Roseburia inulinivorans
          DSM 16841]
 gi|225209859|gb|EEG92213.1| hypothetical protein ROSEINA2194_03953 [Roseburia inulinivorans
          DSM 16841]
          Length = 90

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NKS RS V++  +    A+     E A  A   A S I+ 
Sbjct: 4  LANIKSAKKRILVTETKAARNKSIRSEVKTVTKKVEAAVAANDKEAAKAALTVAISTIES 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N ++RKVSRL+K +  +
Sbjct: 64 AASKGVYHKNNSARKVSRLTKLVNAM 89


>gi|148380919|ref|YP_001255460.1| ribosomal protein S20 [Clostridium botulinum A str. ATCC 3502]
 gi|153930872|ref|YP_001385227.1| 30S ribosomal protein S20 [Clostridium botulinum A str. ATCC
          19397]
 gi|153936697|ref|YP_001388696.1| 30S ribosomal protein S20 [Clostridium botulinum A str. Hall]
 gi|153939730|ref|YP_001392244.1| 30S ribosomal protein S20 [Clostridium botulinum F str.
          Langeland]
 gi|168179398|ref|ZP_02614062.1| ribosomal protein S20 [Clostridium botulinum NCTC 2916]
 gi|170754676|ref|YP_001782600.1| 30S ribosomal protein S20 [Clostridium botulinum B1 str. Okra]
 gi|170758259|ref|YP_001788280.1| 30S ribosomal protein S20 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|226950393|ref|YP_002805484.1| ribosomal protein S20 [Clostridium botulinum A2 str. Kyoto]
 gi|166223927|sp|A7FXM3|RS20_CLOB1 RecName: Full=30S ribosomal protein S20
 gi|166223928|sp|A5I648|RS20_CLOBH RecName: Full=30S ribosomal protein S20
 gi|166223929|sp|A7GHI4|RS20_CLOBL RecName: Full=30S ribosomal protein S20
 gi|226736473|sp|B1ILN1|RS20_CLOBK RecName: Full=30S ribosomal protein S20
 gi|226736474|sp|B1KZP5|RS20_CLOBM RecName: Full=30S ribosomal protein S20
 gi|254813057|sp|C1FVU8|RS20_CLOBJ RecName: Full=30S ribosomal protein S20
 gi|148290403|emb|CAL84530.1| 30S ribosomal protein S20 [Clostridium botulinum A str. ATCC
          3502]
 gi|152926916|gb|ABS32416.1| 30S ribosomal protein S20 [Clostridium botulinum A str. ATCC
          19397]
 gi|152932611|gb|ABS38110.1| 30S ribosomal protein S20 [Clostridium botulinum A str. Hall]
 gi|152935626|gb|ABS41124.1| 30S ribosomal protein S20 [Clostridium botulinum F str.
          Langeland]
 gi|169119888|gb|ACA43724.1| 30S ribosomal protein S20 [Clostridium botulinum B1 str. Okra]
 gi|169405248|gb|ACA53659.1| 30S ribosomal protein S20 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|182669852|gb|EDT81828.1| ribosomal protein S20 [Clostridium botulinum NCTC 2916]
 gi|226841488|gb|ACO84154.1| ribosomal protein S20 [Clostridium botulinum A2 str. Kyoto]
 gi|295320242|gb|ADG00620.1| 30S ribosomal protein S20 [Clostridium botulinum F str. 230613]
 gi|322807286|emb|CBZ04860.1| SSU ribosomal protein S20p [Clostridium botulinum H04402 065]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +SS+++ +++    +    +EEA  A + A   +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMLKSSLKTTIKNFLTVVEGKNVEEAKAAYKTAARALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKGI H N A+R  SRL+ +L  +
Sbjct: 61 SVSKGIVHKNKAARTKSRLAAKLNAL 86


>gi|254495987|ref|ZP_05108894.1| 30S ribosomal protein S20 [Legionella drancourtii LLAP12]
 gi|254354789|gb|EET13417.1| 30S ribosomal protein S20 [Legionella drancourtii LLAP12]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +    N S RS  R+++++  +A+  G  + AT A  KA+ +I K
Sbjct: 1  MANIKSAIKRARQNIKLRQHNASARSMFRTYIKNVLKAVEAGNKDAATAAYTKAQPIIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A +KG+ H N A+R  SRL  R+K
Sbjct: 61 AAAKGLIHKNKAARIKSRLVARVK 84


>gi|89900906|ref|YP_523377.1| 30S ribosomal protein S20 [Rhodoferax ferrireducens T118]
 gi|118573835|sp|Q21WK7|RS20_RHOFD RecName: Full=30S ribosomal protein S20
 gi|89345643|gb|ABD69846.1| SSU ribosomal protein S20P [Rhodoferax ferrireducens T118]
          Length = 100

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G   +ATE   K ++V+     KG
Sbjct: 15 SGRKRVRQDVKINAANTSLRSKYRTAVKNVEKAVVAGDKAKATELFAKMQAVVDTVADKG 74

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          IFH N A+R  SRLS ++K +
Sbjct: 75 IFHKNKAARDKSRLSTKVKAL 95


>gi|320010882|gb|ADW05732.1| ribosomal protein S20 [Streptomyces flavogriseus ATCC 33331]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G +E+AT A R A   + KA SKG+ H NAA+ K S 
Sbjct: 19 LRNKAVKSSLKTSIRKAREAAAAGDVEKATVAVRDASRQLDKAVSKGVIHKNAAANKKSA 78

Query: 79 LS 80
          L+
Sbjct: 79 LA 80


>gi|187778452|ref|ZP_02994925.1| hypothetical protein CLOSPO_02046 [Clostridium sporogenes ATCC
          15579]
 gi|187772077|gb|EDU35879.1| hypothetical protein CLOSPO_02046 [Clostridium sporogenes ATCC
          15579]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +SS+++ +++    +    +EEA  A + A   +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMLKSSLKTTIKNFLTVVEGKNVEEAKVAYKTAARALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKGI H N A+R  SRL+ +L  +
Sbjct: 61 SVSKGIIHKNKAARTKSRLAAKLNAL 86


>gi|118580194|ref|YP_901444.1| 30S ribosomal protein S20 [Pelobacter propionicus DSM 2379]
 gi|166223963|sp|A1APW6|RS20_PELPD RecName: Full=30S ribosomal protein S20
 gi|118502904|gb|ABK99386.1| SSU ribosomal protein S20P [Pelobacter propionicus DSM 2379]
          Length = 87

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SA K I++ A++   N+   S+++++++   EA+     E AT A + A  VI K
Sbjct: 1  MAHHKSAIKRIKQNAKKNARNRHISSTLKTYIKRVREAVEAKDKEAATVALKAAIPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            +KG+ H + ASR VSRL+K
Sbjct: 61 TATKGVIHSSNASRTVSRLTK 81


>gi|269218597|ref|ZP_06162451.1| ribosomal protein S20 [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211708|gb|EEZ78048.1| ribosomal protein S20 [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 47/80 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +R L NK+ +S +++++R   +A+  G +E A  A R A   + K
Sbjct: 1  MANIKSQKKRILTNEKRRLRNKAVKSELKTYVRKTRKAVAAGDVETAQAALRVATRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG+ H N A+ + S+L+
Sbjct: 61 AVSKGVIHKNQAANRKSKLA 80


>gi|329113490|ref|ZP_08242271.1| 30S ribosomal protein S20 [Acetobacter pomorum DM001]
 gi|326697315|gb|EGE48975.1| 30S ribosomal protein S20 [Acetobacter pomorum DM001]
          Length = 62

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          +R+F++    A+  G    A EA R A+  IQ+A +KG+ H N  +RK+SRLS R+K +
Sbjct: 1  MRTFIKKVETAVEAGDHGAAREALRLAQPEIQRAATKGVIHHNTVARKISRLSARVKAL 59


>gi|288871662|ref|ZP_06118454.2| ribosomal protein S20 [Clostridium hathewayi DSM 13479]
 gi|288862576|gb|EFC94874.1| ribosomal protein S20 [Clostridium hathewayi DSM 13479]
          Length = 115

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 2/87 (2%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEAC-RKAESVIQ 59
           +AN  SAKK I     +   NK+ RS V++ ++    A+T G  + A +AC   A + I 
Sbjct: 29  LANIKSAKKRILVNETKAARNKAIRSRVKTSIKKVEAAVTAGD-KAAAQACLTSAIAEID 87

Query: 60  KAKSKGIFHGNAASRKVSRLSKRLKGI 86
           KA +KG++H N ASRKVSR+SK +  +
Sbjct: 88  KAATKGVYHKNTASRKVSRISKAVNAM 114


>gi|296140494|ref|YP_003647737.1| ribosomal protein S20 [Tsukamurella paurometabola DSM 20162]
 gi|296028628|gb|ADG79398.1| ribosomal protein S20 [Tsukamurella paurometabola DSM 20162]
          Length = 86

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   R  L N+S +SS+R+ +RH  EA+  G  ++AT         + K
Sbjct: 1  MANIKSQMKRIKTNERNRLRNQSAKSSLRTAIRHFREAVDAGDKDKATTLLASTSQQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKGI H N A+ K S L+
Sbjct: 61 AASKGIIHANQAANKKSALA 80


>gi|294629293|ref|ZP_06707853.1| 30S ribosomal protein S20 [Streptomyces sp. e14]
 gi|292832626|gb|EFF90975.1| 30S ribosomal protein S20 [Streptomyces sp. e14]
          Length = 88

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 3/88 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NK+ +SS+++ +R A EA   G +E+ATE  R A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNKAVKSSLKTAIRKAREAAAAGDVEKATEYQRAAARQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKR---LKG 85
          A SKG+ H N A+ K S L+ +   LKG
Sbjct: 61 AVSKGVIHKNQAANKKSALASKVAALKG 88


>gi|289548308|ref|YP_003473296.1| ribosomal protein S20 [Thermocrinis albus DSM 14484]
 gi|289181925|gb|ADC89169.1| ribosomal protein S20 [Thermocrinis albus DSM 14484]
          Length = 96

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N   A K +R+ A+R   N+   S +R+++R   + +  GK+EEA     +  S+I  
Sbjct: 1  MPNTRQAAKRMRRDAKRRERNRYHLSRMRTYIRKFRKMVQEGKLEEAKAFLPEVISIIYH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            SKG+ H N A+R+ SR+++ L   L  A
Sbjct: 61 TASKGVIHKNEAARRASRVTQLLNKALAQA 90


>gi|167758058|ref|ZP_02430185.1| hypothetical protein CLOSCI_00396 [Clostridium scindens ATCC 35704]
 gi|167663955|gb|EDS08085.1| hypothetical protein CLOSCI_00396 [Clostridium scindens ATCC 35704]
          Length = 108

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 48/86 (55%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK I     +   NK+ +S V++ ++    AI     E A  A + A   I K
Sbjct: 22  LANIKSAKKRILVNETKAARNKAIKSKVKTCVKKVETAIANKDAEAAKAALKVAIVEINK 81

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A SKG++H N  SRK+SRL+K + GI
Sbjct: 82  AGSKGVYHKNTCSRKISRLTKAVNGI 107


>gi|328949988|ref|YP_004367323.1| 30S ribosomal protein S20 [Marinithermus hydrothermalis DSM
          14884]
 gi|328450312|gb|AEB11213.1| 30S ribosomal protein S20 [Marinithermus hydrothermalis DSM
          14884]
          Length = 96

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 1  MANK----DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAES 56
          MANK     SA K  R+  +R   NK+++S +++F + A  A   G  E A +  R AES
Sbjct: 1  MANKSARTPSAMKRHRQSLKRRARNKAKKSMIKTFTKKAIAAAESGDKEAALKYMRVAES 60

Query: 57 VIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          +I KA      H NAA+R+ SRL K+L  +L S
Sbjct: 61 LIDKAAKGPTLHKNAAARRKSRLMKKLHKLLGS 93


>gi|242238037|ref|YP_002986218.1| 30S ribosomal protein S20 [Dickeya dadantii Ech703]
 gi|242130094|gb|ACS84396.1| ribosomal protein S20 [Dickeya dadantii Ech703]
          Length = 87

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVQAAIATGDKETAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
            SKG+ H N A+R  SRL
Sbjct: 61 QASKGLIHKNKAARHKSRL 79


>gi|78357074|ref|YP_388523.1| 30S ribosomal protein S20 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
 gi|115305682|sp|Q30ZR8|RS20_DESDG RecName: Full=30S ribosomal protein S20
 gi|78219479|gb|ABB38828.1| SSU ribosomal protein S20P [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
          Length = 87

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++  +R   N++ ++ +++ ++    A+T    E+A      A SV+ K
Sbjct: 1  MANHKSAIKRHKQSVKRAARNRAVKTRIKNAIKAVRTAVTEKDKEQAQAKLTDAMSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H   A+RK+SRLSK + GI
Sbjct: 61 ASSKGVIHWKNAARKISRLSKAVDGI 86


>gi|253574663|ref|ZP_04852003.1| 30S ribosomal protein S20 [Paenibacillus sp. oral taxon 786 str.
          D14]
 gi|251845709|gb|EES73717.1| 30S ribosomal protein S20 [Paenibacillus sp. oral taxon 786 str.
          D14]
          Length = 93

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++  + A+   ++E A  A   A   + K
Sbjct: 4  MPNIKSAIKRVKTSDKRRALNASQKSALRTAVKTVDTALANNEVEAAKAAFVAATKKLDK 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H NAA+RK SRL+K+L  + + A
Sbjct: 64 AVTKGLIHKNAAARKKSRLAKKLNELTSQA 93


>gi|90580546|ref|ZP_01236351.1| putative ribosomal protein S20 [Vibrio angustum S14]
 gi|90438204|gb|EAS63390.1| putative ribosomal protein S20 [Photobacterium angustum S14]
          Length = 86

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G  E AT+A  + + V+ +
Sbjct: 1  MANIKSAKKRALTSEKRRQHNASRRSMMRTFFKKVIIAIEAGNKEAATQAFVEMQPVMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKARLAAKIKAL 86


>gi|160897624|ref|YP_001563206.1| 30S ribosomal protein S20 [Delftia acidovorans SPH-1]
 gi|160363208|gb|ABX34821.1| ribosomal protein S20 [Delftia acidovorans SPH-1]
          Length = 97

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ ++   +A+  G   +ATE    A+SV+     KG
Sbjct: 14 SGRKRVRQDTKLNAANTSLRSKYRTAVKKVEKAVLTGDKAKATELFAAAQSVLDTIADKG 73

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          IFH N A+R  SRLS ++K +
Sbjct: 74 IFHKNKAARDKSRLSAKVKAL 94


>gi|148978529|ref|ZP_01814981.1| 30S ribosomal protein S20 [Vibrionales bacterium SWAT-3]
 gi|145962318|gb|EDK27599.1| 30S ribosomal protein S20 [Vibrionales bacterium SWAT-3]
          Length = 86

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A  +   ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTIAAIAAGDKEAATAALVEVTPLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR +  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAAIKAL 86


>gi|254515461|ref|ZP_05127521.1| ribosomal protein S20 [gamma proteobacterium NOR5-3]
 gi|219675183|gb|EED31549.1| ribosomal protein S20 [gamma proteobacterium NOR5-3]
          Length = 122

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN   A+K  R+  +R   N S RS VR+ +++   A+  G  E+A  A  KA  VI +
Sbjct: 35  VANSPQARKRARQSEKRRSHNASLRSLVRTNIKNVLAAVKTGDAEQALAAYTKAVPVIDR 94

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
              KGI H N A+R  SRL+ ++K +
Sbjct: 95  MADKGIIHKNKAARHKSRLNAQVKAL 120


>gi|331270020|ref|YP_004396512.1| 30S ribosomal protein S20 [Clostridium botulinum BKT015925]
 gi|329126570|gb|AEB76515.1| ribosomal protein S20 [Clostridium botulinum BKT015925]
          Length = 88

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +S++++ +++   A+    + EA  A       +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMIKSALKTQIKNFEVAVANNDLNEAKSAYTTVVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+RK SRL+ +L  +
Sbjct: 61 AAAKGILHKNKAARKKSRLASKLSAL 86


>gi|297568427|ref|YP_003689771.1| ribosomal protein S20 [Desulfurivibrio alkaliphilus AHT2]
 gi|296924342|gb|ADH85152.1| ribosomal protein S20 [Desulfurivibrio alkaliphilus AHT2]
          Length = 90

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+   R   N+S RS +++  R  +EAI     E+A +A + A  +I K
Sbjct: 1  MANHKSAMKRNRQNVVRRERNRSNRSRLKTLYRRIDEAIVANSPEQARQALQNAVPMIAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A ++G+ H N A+RK+SRL++R+  
Sbjct: 61 AVNQGVLHRNTAARKISRLTRRVNA 85


>gi|149174726|ref|ZP_01853351.1| probable 30S ribosomal protein S20 [Planctomyces maris DSM 8797]
 gi|148846420|gb|EDL60758.1| probable 30S ribosomal protein S20 [Planctomyces maris DSM 8797]
          Length = 90

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAK+ +RK   R L N+S RS +RS +++A  AI+    + A +A + A   I +
Sbjct: 1  MPNTKSAKRALRKSDVRRLRNRSTRSELRSAVKNARAAISGDDAQAAAQALQAAAKQIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KGI H NAA+R  SRL+K
Sbjct: 61 AAAKGIIHKNAAARTKSRLAK 81


>gi|187478600|ref|YP_786624.1| 30S ribosomal protein S20 [Bordetella avium 197N]
 gi|114152131|sp|Q2KZD7|RS20_BORA1 RecName: Full=30S ribosomal protein S20
 gi|115423186|emb|CAJ49717.1| 30S ribosomal protein S20 [Bordetella avium 197N]
          Length = 87

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N S RS +R+ ++   +AI  G    A E  RKA SVI +
Sbjct: 1  MANTAQARKRARQSVERNKHNSSLRSMLRTAIKRVRQAIATGDKAVAGETLRKASSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 61 VADKNIIHKNKAARHKSRLAAAVKAL 86


>gi|262376175|ref|ZP_06069405.1| ribosomal protein S20 [Acinetobacter lwoffii SH145]
 gi|262308776|gb|EEY89909.1| ribosomal protein S20 [Acinetobacter lwoffii SH145]
          Length = 89

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI+      ATEA +    VI +
Sbjct: 1  MANSAQAKKRARQNVKARKHNASLRSMVRTYLKRTLAAISTNDYAVATEAYKSLVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQVKAL 86


>gi|297565393|ref|YP_003684365.1| 30S ribosomal protein S20 [Meiothermus silvanus DSM 9946]
 gi|296849842|gb|ADH62857.1| ribosomal protein S20 [Meiothermus silvanus DSM 9946]
          Length = 97

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%)

Query: 5  DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSK 64
           SA K  R+  +R   N+S++S++++  + A      G  EEAT+  R AES+I KA   
Sbjct: 10 PSAMKRHRQSLKRRAANRSKKSTIKTISKKAVALAQEGNTEEATKFLRLAESLIDKAAKG 69

Query: 65 GIFHGNAASRKVSRLSKRLKGILTS 89
             H  AASRK SRL+K +  +LT+
Sbjct: 70 STLHKRAASRKKSRLAKSVSKLLTA 94


>gi|261250332|ref|ZP_05942908.1| SSU ribosomal protein S20p [Vibrio orientalis CIP 102891]
 gi|312884035|ref|ZP_07743752.1| 30S ribosomal protein S20 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|260939448|gb|EEX95434.1| SSU ribosomal protein S20p [Vibrio orientalis CIP 102891]
 gi|309368493|gb|EFP96028.1| 30S ribosomal protein S20 [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 86

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G    ATEA      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKAAATEAFATVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR +  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAAIKAL 86


>gi|218708567|ref|YP_002416188.1| 30S ribosomal protein S20 [Vibrio splendidus LGP32]
 gi|254813074|sp|B7VJ84|RS20_VIBSL RecName: Full=30S ribosomal protein S20
 gi|218321586|emb|CAV17538.1| 30S ribosomal protein S20 [Vibrio splendidus LGP32]
          Length = 86

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A  +   ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTIAAIEAGNKEAATAALVEVTPLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR +  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAAIKAL 86


>gi|223939174|ref|ZP_03631056.1| ribosomal protein S20 [bacterium Ellin514]
 gi|223892127|gb|EEF58606.1| ribosomal protein S20 [bacterium Ellin514]
          Length = 87

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA++ +R  AR+   N+S  + + +  ++  + +T GK +EAT+A +   S + K
Sbjct: 1  MPNTKSAERRMRNSARKQKNNRSTTTRLHTLEKNYLQLVTAGKKDEATKAYQAVTSALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   G  H + ASRK SRL+ RL  +
Sbjct: 61 AAKTGTVHRSTASRKKSRLALRLNKV 86


>gi|227495922|ref|ZP_03926233.1| ribosomal protein S20 [Actinomyces urogenitalis DSM 15434]
 gi|226834538|gb|EEH66921.1| ribosomal protein S20 [Actinomyces urogenitalis DSM 15434]
          Length = 86

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L N+S +S +++++R   EA+  G    A E  +KA   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNQSVKSELKTYVRRVREAVEAGDKAAAEEGLKKAARKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGI H N A+ + S+L+KR+  I
Sbjct: 61 AASKGIIHRNQAANRKSKLAKRVASI 86


>gi|239827784|ref|YP_002950408.1| 30S ribosomal protein S20 [Geobacillus sp. WCH70]
 gi|259494865|sp|C5D4V0|RS20_GEOSW RecName: Full=30S ribosomal protein S20
 gi|239808077|gb|ACS25142.1| ribosomal protein S20 [Geobacillus sp. WCH70]
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +   +R   N S RS++R+ ++     +    +E+A EA   A   + K
Sbjct: 1  MANIKSAIKRAKTSEKRRAHNASMRSAMRTAIKKFEAFVELKDVEKAQEAFIIASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A +KG+ H N ASRK SRL+K+L  I+ S
Sbjct: 61 AVTKGLIHKNTASRKKSRLAKKLNSIIAS 89


>gi|87123004|ref|ZP_01078863.1| 30S ribosomal protein S20 [Marinomonas sp. MED121]
 gi|86161721|gb|EAQ63027.1| 30S ribosomal protein S20 [Marinomonas sp. MED121]
          Length = 88

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+  +R   N   RS VR++++  + AI  G   +A  A   A S + K
Sbjct: 1  MANSAGSKKRARQAIKRRAHNGGLRSMVRTYLKKVDAAIEAGNQADAQAAFVAATSQMDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG++H N ASR  SRLS ++K +
Sbjct: 61 AAGKGLYHKNKASRHKSRLSAKIKAL 86


>gi|152984043|ref|YP_001350535.1| 30S ribosomal protein S20 [Pseudomonas aeruginosa PA7]
 gi|166223970|sp|A6VBV0|RS20_PSEA7 RecName: Full=30S ribosomal protein S20
 gi|150959201|gb|ABR81226.1| ribosomal protein S20 [Pseudomonas aeruginosa PA7]
          Length = 91

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 51/90 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI    + +A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDLAKAQAAFTAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R  SRLS  +K + T+A
Sbjct: 61 MADKGIIHKNKAARHKSRLSGHIKALSTAA 90


>gi|307543903|ref|YP_003896382.1| 30S ribosomal protein S20 [Halomonas elongata DSM 2581]
 gi|307215927|emb|CBV41197.1| 30S ribosomal protein S20 [Halomonas elongata DSM 2581]
          Length = 88

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R ++  S+RS VR+++++  +AI  G   +A +A ++A+ VI +
Sbjct: 1  MANTKQARKRARQAEGRRVLKASQRSMVRTYVKNVIKAINGGDHAQAMDAFKQAQPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K +     A+R  SRL+KR+K +
Sbjct: 61 IADKDVISKKKAARLKSRLNKRIKAL 86


>gi|147677204|ref|YP_001211419.1| 30S ribosomal protein S20 [Pelotomaculum thermopropionicum SI]
 gi|189044873|sp|A5D3X2|RS20_PELTS RecName: Full=30S ribosomal protein S20
 gi|146273301|dbj|BAF59050.1| ribosomal protein S20 [Pelotomaculum thermopropionicum SI]
          Length = 88

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +    +RT+ N   +S++++ +R   EA+     +EA    R A   I K
Sbjct: 1  MPNIKSAAKRVEVTRKRTMRNTRIKSALKTTIRKFEEALKNASHDEARLKLRNAIRAIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG+ H N ASRK SRL+KR 
Sbjct: 61 AVTKGVLHKNTASRKKSRLTKRF 83


>gi|253682386|ref|ZP_04863183.1| ribosomal protein S20 [Clostridium botulinum D str. 1873]
 gi|253562098|gb|EES91550.1| ribosomal protein S20 [Clostridium botulinum D str. 1873]
          Length = 88

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +S++++ +++   A+    + EA  A       +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKMIKSALKTKIKNFEVAVANNDLNEAKSAYTTVVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+RK SRL+ +L  +
Sbjct: 61 AAAKGILHKNKAARKKSRLASKLSAL 86


>gi|302874293|ref|YP_003842926.1| 30S ribosomal protein S20 [Clostridium cellulovorans 743B]
 gi|307689442|ref|ZP_07631888.1| 30S ribosomal protein S20 [Clostridium cellulovorans 743B]
 gi|302577150|gb|ADL51162.1| ribosomal protein S20 [Clostridium cellulovorans 743B]
          Length = 86

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I ++TL NK  +S++++ ++    A+     EEA          +  
Sbjct: 1  MANIKSAKKRIKVIEKKTLRNKMIKSALKTTIKKFEVAVDAKNAEEAKANFNNVVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGI H N A+RK SRLS +L  +
Sbjct: 61 AASKGIVHSNKAARKKSRLSAKLSAM 86


>gi|91205851|ref|YP_538206.1| 30S ribosomal protein S20 [Rickettsia bellii RML369-C]
 gi|157826789|ref|YP_001495853.1| 30S ribosomal protein S20 [Rickettsia bellii OSU 85-389]
 gi|118573839|sp|Q1RHP7|RS20_RICBR RecName: Full=30S ribosomal protein S20
 gi|166223978|sp|A8GVD9|RS20_RICB8 RecName: Full=30S ribosomal protein S20
 gi|91069395|gb|ABE05117.1| 30S ribosomal protein S20 [Rickettsia bellii RML369-C]
 gi|157802093|gb|ABV78816.1| 30S ribosomal protein S20 [Rickettsia bellii OSU 85-389]
          Length = 87

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+  ++TL+NK R S++++F++     I  G  EEA  A   A+S I +
Sbjct: 1  MANHSSAKKAARQTVKKTLVNKRRASAIKTFVKKVLHEINQGNKEEANSALVIAQSKIMQ 60

Query: 61 AKSKGIFHGNAASRKVS 77
             K I   N ASRK+S
Sbjct: 61 GVKKNIIKLNTASRKIS 77


>gi|313892117|ref|ZP_07825712.1| ribosomal protein S20 [Dialister microaerophilus UPII 345-E]
 gi|313119472|gb|EFR42669.1| ribosomal protein S20 [Dialister microaerophilus UPII 345-E]
          Length = 85

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA   ++ K IR+  + T  N S +S +R+ ++   +AI     E+ TE+ R A SVI  
Sbjct: 1  MAQIKASIKSIRQDIKITAANASVKSEIRTAVK---KAIAAAGTEQETESLRSAISVIDS 57

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A+ KGI H N A+RK SRL+ R+K 
Sbjct: 58 AERKGIIHKNNAARKKSRLNARIKA 82


>gi|146281347|ref|YP_001171500.1| 30S ribosomal protein S20 [Pseudomonas stutzeri A1501]
 gi|166223973|sp|A4VI57|RS20_PSEU5 RecName: Full=30S ribosomal protein S20
 gi|145569552|gb|ABP78658.1| 30S ribosomal protein S20 [Pseudomonas stutzeri A1501]
 gi|327479526|gb|AEA82836.1| 30S ribosomal protein S20 [Pseudomonas stutzeri DSM 4166]
          Length = 92

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S RS VR+++++  +AI    +++A  A   A  VI +
Sbjct: 1  MANSPSAKKRAIQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDLDKARAAYTAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+  +K +
Sbjct: 61 MADKGIIHKNKAARHKSRLNGHIKAL 86


>gi|221065679|ref|ZP_03541784.1| ribosomal protein S20 [Comamonas testosteroni KF-1]
 gi|264679768|ref|YP_003279677.1| ribosomal protein S20 [Comamonas testosteroni CNB-2]
 gi|220710702|gb|EED66070.1| ribosomal protein S20 [Comamonas testosteroni KF-1]
 gi|262210283|gb|ACY34381.1| ribosomal protein S20 [Comamonas testosteroni CNB-2]
          Length = 97

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K  R+  +    N S RS  R+ +++  +A+  G   +A E   KA+SVI     KG
Sbjct: 13 SGRKRARQNVKLNAANTSLRSKYRTAVKNVEKAVVAGDKTKAAELFAKAQSVIDAIADKG 72

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
          IFH N A+R  SRLS ++K +  +A
Sbjct: 73 IFHKNKAARDKSRLSAKVKTLALAA 97


>gi|291287589|ref|YP_003504405.1| 30S ribosomal protein S20 [Denitrovibrio acetiphilus DSM 12809]
 gi|290884749|gb|ADD68449.1| ribosomal protein S20 [Denitrovibrio acetiphilus DSM 12809]
          Length = 89

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SA K IR+  ++ L NK+ +S +R+ ++    A     +E A +A  +A  ++ K
Sbjct: 1  MAHTLSANKRIRQSEKKKLRNKAYKSKMRTVVKKFYTAADTNDVETAEKAYMEAVKIVSK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H + ASR+VSRL+ +L  +
Sbjct: 61 VGQKGVIHESQASRRVSRLTLKLNAV 86


>gi|239979392|ref|ZP_04701916.1| 30S ribosomal protein S20 [Streptomyces albus J1074]
 gi|291451267|ref|ZP_06590657.1| 30S ribosomal protein S20 [Streptomyces albus J1074]
 gi|291354216|gb|EFE81118.1| 30S ribosomal protein S20 [Streptomyces albus J1074]
          Length = 88

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA+  G  E+ATE  R A   + KA SKG+ H N A+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAVAAGDAEKATEYTRAASRQLDKAVSKGVIHKNQAANKKSA 78

Query: 79 LSKR---LKG 85
          L+ +   LKG
Sbjct: 79 LATQTAALKG 88


>gi|153953528|ref|YP_001394293.1| 30S ribosomal protein S20 [Clostridium kluyveri DSM 555]
 gi|219854150|ref|YP_002471272.1| hypothetical protein CKR_0807 [Clostridium kluyveri NBRC 12016]
 gi|189044856|sp|A5N6L4|RS20_CLOK5 RecName: Full=30S ribosomal protein S20
 gi|254813059|sp|B9E033|RS20_CLOK1 RecName: Full=30S ribosomal protein S20
 gi|146346409|gb|EDK32945.1| Hypothetical protein CKL_0894 [Clostridium kluyveri DSM 555]
 gi|219567874|dbj|BAH05858.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 88

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +SS+++ ++    A+  G +EEA  +       +  
Sbjct: 1  MANIKSAKKRIKVIKTKTLRNKIIKSSLKTTIKKFLAAVESGNVEEAKVSFTATVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N ASR  S+L+ +L
Sbjct: 61 AASKGVIHKNKASRNKSKLALKL 83


>gi|237801847|ref|ZP_04590308.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|331024705|gb|EGI04761.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 92

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASMRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R   RL+  +K +  +A
Sbjct: 61 MADKGIIHKNKAARHKGRLNGHIKALSLAA 90


>gi|207109987|ref|ZP_03244149.1| 30S ribosomal protein S20 [Helicobacter pylori HPKX_438_CA4C1]
          Length = 78

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ V++ ++   EA+    + +A E  + A   + K
Sbjct: 1  MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKAVREAVAVNDVAKAQERLKIANKELHK 60

Query: 61 AKSKGIFHGNAASRKVSR 78
            SKGI   N ASRKVSR
Sbjct: 61 FVSKGILKKNTASRKVSR 78


>gi|91202665|emb|CAJ72304.1| similar to 30S ribosomal protein RpsT [Candidatus Kuenenia
          stuttgartiensis]
          Length = 94

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 49/90 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M    SAKK +R+   R LINKSR++++++ ++    A+    I+ A          + K
Sbjct: 1  MPTTSSAKKRLRQDETRNLINKSRKTALKTQVKKFLTALQSKDIQAAEAEYSLTVKKMDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +KGI H N ASRK SR +K+L  +  SA
Sbjct: 61 GAAKGILHKNNASRKKSRFAKKLNDLKASA 90


>gi|90020660|ref|YP_526487.1| 30S ribosomal protein S20 [Saccharophagus degradans 2-40]
 gi|118573842|sp|Q21M04|RS20_SACD2 RecName: Full=30S ribosomal protein S20
 gi|89950260|gb|ABD80275.1| SSU ribosomal protein S20P [Saccharophagus degradans 2-40]
          Length = 88

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI  G  E A  A   A  V+ +
Sbjct: 1  MANSPQAKKRARQNDKARAHNASLRSMVRTYLKKVVAAIEAGDAETAKAAYAVAIPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++K +
Sbjct: 61 VADKGIIHKNKAARHKSRLNAKIKAL 86


>gi|319779512|ref|YP_004130425.1| SSU ribosomal protein S20p [Taylorella equigenitalis MCE9]
 gi|317109536|gb|ADU92282.1| SSU ribosomal protein S20p [Taylorella equigenitalis MCE9]
          Length = 90

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+       N S RS +R+ ++   +AI  G  E+A EA   A SVI +
Sbjct: 1  MANTSQARKRARQAIALNKHNSSLRSLLRTSIKRVRQAIEAGDKEKANEALNSASSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K I
Sbjct: 61 VADKKIIHKNKAARHKSRLSAAIKAI 86


>gi|163782674|ref|ZP_02177671.1| ribosomal protein S20 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882247|gb|EDP75754.1| ribosomal protein S20 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 92

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N+   S +R++++     +  GK+EEA E   +  S+IQ   SKG+ H N ASR+VSR+ 
Sbjct: 21 NRYHLSRMRTYIKKFRRMVQEGKLEEAKEFLPQVVSIIQHTASKGVIHKNEASRRVSRVQ 80

Query: 81 KRL 83
          + L
Sbjct: 81 ELL 83


>gi|148244835|ref|YP_001219529.1| 30S ribosomal protein S20 [Candidatus Vesicomyosocius okutanii
          HA]
 gi|166224000|sp|A5CW82|RS20_VESOH RecName: Full=30S ribosomal protein S20
 gi|146326662|dbj|BAF61805.1| 30S ribosomal protein S20 [Candidatus Vesicomyosocius okutanii
          HA]
          Length = 86

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S++K  R+  +R   N   R+ VR+F++    A+  G  E+A       + ++ +
Sbjct: 1  MANSASSRKRARQAVKRNKHNSQIRAKVRTFIKKVTYALEAGNKEQAQNCFTIMQKMLDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N A+RK SRL+ ++K +
Sbjct: 61 AVNKGLIHKNQAARKKSRLNSQIKAL 86


>gi|158320260|ref|YP_001512767.1| ribosomal protein S20 [Alkaliphilus oremlandii OhILAs]
 gi|167011208|sp|A8MFA2|RS20_ALKOO RecName: Full=30S ribosomal protein S20
 gi|158140459|gb|ABW18771.1| ribosomal protein S20 [Alkaliphilus oremlandii OhILAs]
          Length = 87

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K I  I ++T  N+  +S +++ +R   E++  G  EEA    +  E  + +
Sbjct: 1  MANIKSAQKRILVINKKTARNRMIKSQLKTAIRRFEESLAAGNFEEAKTRLKLVEKKLHQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG  H   ASRKVSRL+ +L
Sbjct: 61 AAAKGTIHKAKASRKVSRLATKL 83


>gi|28868030|ref|NP_790649.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|66043972|ref|YP_233813.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. syringae
          B728a]
 gi|71735569|ref|YP_273010.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|213971066|ref|ZP_03399186.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tomato T1]
 gi|257487506|ref|ZP_05641547.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|289625173|ref|ZP_06458127.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. aesculi str.
          NCPPB3681]
 gi|289651357|ref|ZP_06482700.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. aesculi str.
          2250]
 gi|289674843|ref|ZP_06495733.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. syringae FF5]
 gi|301384211|ref|ZP_07232629.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tomato Max13]
 gi|302060865|ref|ZP_07252406.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tomato K40]
 gi|302132870|ref|ZP_07258860.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tomato NCPPB
          1108]
 gi|302185236|ref|ZP_07261909.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. syringae 642]
 gi|38258474|sp|Q889E8|RS20_PSESM RecName: Full=30S ribosomal protein S20
 gi|75503519|sp|Q4ZYJ7|RS20_PSEU2 RecName: Full=30S ribosomal protein S20
 gi|115305700|sp|Q48NK9|RS20_PSE14 RecName: Full=30S ribosomal protein S20
 gi|28851266|gb|AAO54344.1| ribosomal protein S20 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|63254679|gb|AAY35775.1| Ribosomal protein S20p [Pseudomonas syringae pv. syringae B728a]
 gi|71556122|gb|AAZ35333.1| ribosomal protein S20 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|213924174|gb|EEB57749.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tomato T1]
 gi|320326226|gb|EFW82280.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. glycinea str.
          B076]
 gi|320330651|gb|EFW86628.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|330869169|gb|EGH03878.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. aesculi str.
          0893_23]
 gi|330878960|gb|EGH13109.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. morsprunorum
          str. M302280PT]
 gi|330881364|gb|EGH15513.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|330891596|gb|EGH24257.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. mori str.
          301020]
 gi|330941231|gb|EGH44096.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. pisi str.
          1704B]
 gi|330954235|gb|EGH54495.1| 30S ribosomal protein S20 [Pseudomonas syringae Cit 7]
 gi|330961579|gb|EGH61839.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. maculicola
          str. ES4326]
 gi|330966385|gb|EGH66645.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. actinidiae
          str. M302091]
 gi|330971962|gb|EGH72028.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. aceris str.
          M302273PT]
 gi|330988783|gb|EGH86886.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331008748|gb|EGH88804.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|331018365|gb|EGH98421.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
          Length = 92

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R   RL+  +K +  +A
Sbjct: 61 MADKGIIHKNKAARHKGRLNGHIKALSLAA 90


>gi|295695852|ref|YP_003589090.1| ribosomal protein S20 [Bacillus tusciae DSM 2912]
 gi|295411454|gb|ADG05946.1| ribosomal protein S20 [Bacillus tusciae DSM 2912]
          Length = 96

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +RTL N S +S +R+ ++  +  +  G +E A    R+A   I K
Sbjct: 1  MPNIKSAIKRVQITRKRTLRNASLKSMLRTAIKKFHVTLQSGDLEAAERQLREAIRRIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          + +KGI H NAA+RK SRL+++ + 
Sbjct: 61 SVTKGILHRNAAARKKSRLTRKFQA 85


>gi|297160560|gb|ADI10272.1| 30S ribosomal protein S20 [Streptomyces bingchenggensis BCW-1]
          Length = 88

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NKS +S +++ +R   EA+  G  E+AT A R A   + KA SKG+ H N+A+ K S 
Sbjct: 19 LRNKSVKSELKTAIRRTREAVAAGDAEKATAAARVASRKLDKAVSKGVIHKNSAANKKSA 78

Query: 79 LSKRLKGI 86
          L+ ++ G+
Sbjct: 79 LATQVAGL 86


>gi|328907128|gb|EGG26894.1| 30S ribosomal protein S20 [Propionibacterium sp. P08]
          Length = 88

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S++R+++R+   A   G +E AT+A R A   + KA SKG+ H N A+ + S +S
Sbjct: 21 NKAVKSALRTYVRNFRRAAEAGDVEAATKAARVANRQLDKAASKGVIHKNQAANRKSAIS 80

Query: 81 KRLKGI 86
          K+L  +
Sbjct: 81 KKLNSL 86


>gi|138896085|ref|YP_001126538.1| 30S ribosomal protein S20 [Geobacillus thermodenitrificans
          NG80-2]
 gi|196248979|ref|ZP_03147679.1| ribosomal protein S20 [Geobacillus sp. G11MC16]
 gi|166223938|sp|A4IR39|RS20_GEOTN RecName: Full=30S ribosomal protein S20
 gi|134267598|gb|ABO67793.1| 30S ribosomal protein S20 [Geobacillus thermodenitrificans
          NG80-2]
 gi|196211855|gb|EDY06614.1| ribosomal protein S20 [Geobacillus sp. G11MC16]
          Length = 89

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +   +R   N S +S++R+ ++     +    +E+A EA   A   + K
Sbjct: 1  MANIKSAIKRAKTSEKRRAHNASMKSAMRTAIKKFEALVELKDVEKAQEAFIIASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H NAASR+ SRL+K+L  I  S
Sbjct: 61 AASKGLIHKNAASRQKSRLAKKLNSIQAS 89


>gi|70732629|ref|YP_262392.1| 30S ribosomal protein S20 [Pseudomonas fluorescens Pf-5]
 gi|115305701|sp|Q4K5U1|RS20_PSEF5 RecName: Full=30S ribosomal protein S20
 gi|68346928|gb|AAY94534.1| ribosomal protein S20 [Pseudomonas fluorescens Pf-5]
          Length = 92

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANSPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R   RL+  +K +
Sbjct: 61 MADKGIIHKNKAARHKGRLNGHIKAL 86


>gi|284006372|emb|CBA71608.1| 30S ribosomal protein S20 [Arsenophonus nasoniae]
          Length = 86

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKRRQHNASRRSMVRTFIKKVYAAIATGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  + L  ++K +
Sbjct: 61 YASKGLIHKNKAARHKANLVAQIKSM 86


>gi|229820232|ref|YP_002881758.1| ribosomal protein S20 [Beutenbergia cavernae DSM 12333]
 gi|259494854|sp|C5C483|RS20_BEUC1 RecName: Full=30S ribosomal protein S20
 gi|229566145|gb|ACQ79996.1| ribosomal protein S20 [Beutenbergia cavernae DSM 12333]
          Length = 86

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K IR   +    NK+ +S +++ +R   EA+T G  E A++A + A   + K
Sbjct: 1  MANIKSQIKRIRTNEKARQRNKAYKSELKTHVRKVREAVTAGDKETASDALQVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S L+K++ G+
Sbjct: 61 AVSKGVIHKNQAANRKSALAKQVSGL 86


>gi|50842384|ref|YP_055611.1| 30S ribosomal protein S20 [Propionibacterium acnes KPA171202]
 gi|289425272|ref|ZP_06427049.1| ribosomal protein S20 [Propionibacterium acnes SK187]
 gi|289427057|ref|ZP_06428773.1| ribosomal protein S20 [Propionibacterium acnes J165]
 gi|295130460|ref|YP_003581123.1| ribosomal protein S20 [Propionibacterium acnes SK137]
 gi|59798679|sp|Q6A9B3|RS20_PROAC RecName: Full=30S ribosomal protein S20
 gi|50839986|gb|AAT82653.1| 30S ribosomal protein S20 [Propionibacterium acnes KPA171202]
 gi|289154250|gb|EFD02938.1| ribosomal protein S20 [Propionibacterium acnes SK187]
 gi|289159526|gb|EFD07714.1| ribosomal protein S20 [Propionibacterium acnes J165]
 gi|291376834|gb|ADE00689.1| ribosomal protein S20 [Propionibacterium acnes SK137]
 gi|313764597|gb|EFS35961.1| ribosomal protein S20 [Propionibacterium acnes HL013PA1]
 gi|313772365|gb|EFS38331.1| ribosomal protein S20 [Propionibacterium acnes HL074PA1]
 gi|313792287|gb|EFS40388.1| ribosomal protein S20 [Propionibacterium acnes HL110PA1]
 gi|313801764|gb|EFS42998.1| ribosomal protein S20 [Propionibacterium acnes HL110PA2]
 gi|313807376|gb|EFS45863.1| ribosomal protein S20 [Propionibacterium acnes HL087PA2]
 gi|313809885|gb|EFS47606.1| ribosomal protein S20 [Propionibacterium acnes HL083PA1]
 gi|313813078|gb|EFS50792.1| ribosomal protein S20 [Propionibacterium acnes HL025PA1]
 gi|313816134|gb|EFS53848.1| ribosomal protein S20 [Propionibacterium acnes HL059PA1]
 gi|313818424|gb|EFS56138.1| ribosomal protein S20 [Propionibacterium acnes HL046PA2]
 gi|313820186|gb|EFS57900.1| ribosomal protein S20 [Propionibacterium acnes HL036PA1]
 gi|313823006|gb|EFS60720.1| ribosomal protein S20 [Propionibacterium acnes HL036PA2]
 gi|313825066|gb|EFS62780.1| ribosomal protein S20 [Propionibacterium acnes HL063PA1]
 gi|313827963|gb|EFS65677.1| ribosomal protein S20 [Propionibacterium acnes HL063PA2]
 gi|313830799|gb|EFS68513.1| ribosomal protein S20 [Propionibacterium acnes HL007PA1]
 gi|313834016|gb|EFS71730.1| ribosomal protein S20 [Propionibacterium acnes HL056PA1]
 gi|313838594|gb|EFS76308.1| ribosomal protein S20 [Propionibacterium acnes HL086PA1]
 gi|314915591|gb|EFS79422.1| ribosomal protein S20 [Propionibacterium acnes HL005PA4]
 gi|314918454|gb|EFS82285.1| ribosomal protein S20 [Propionibacterium acnes HL050PA1]
 gi|314919942|gb|EFS83773.1| ribosomal protein S20 [Propionibacterium acnes HL050PA3]
 gi|314923139|gb|EFS86970.1| ribosomal protein S20 [Propionibacterium acnes HL001PA1]
 gi|314925415|gb|EFS89246.1| ribosomal protein S20 [Propionibacterium acnes HL036PA3]
 gi|314931956|gb|EFS95787.1| ribosomal protein S20 [Propionibacterium acnes HL067PA1]
 gi|314955823|gb|EFT00223.1| ribosomal protein S20 [Propionibacterium acnes HL027PA1]
 gi|314958305|gb|EFT02408.1| ribosomal protein S20 [Propionibacterium acnes HL002PA1]
 gi|314960140|gb|EFT04242.1| ribosomal protein S20 [Propionibacterium acnes HL002PA2]
 gi|314962946|gb|EFT07046.1| ribosomal protein S20 [Propionibacterium acnes HL082PA1]
 gi|314966907|gb|EFT11006.1| ribosomal protein S20 [Propionibacterium acnes HL082PA2]
 gi|314973223|gb|EFT17319.1| ribosomal protein S20 [Propionibacterium acnes HL053PA1]
 gi|314975895|gb|EFT19990.1| ribosomal protein S20 [Propionibacterium acnes HL045PA1]
 gi|314978346|gb|EFT22440.1| ribosomal protein S20 [Propionibacterium acnes HL072PA2]
 gi|314983637|gb|EFT27729.1| ribosomal protein S20 [Propionibacterium acnes HL005PA1]
 gi|314987585|gb|EFT31676.1| ribosomal protein S20 [Propionibacterium acnes HL005PA2]
 gi|314990070|gb|EFT34161.1| ribosomal protein S20 [Propionibacterium acnes HL005PA3]
 gi|315078159|gb|EFT50210.1| ribosomal protein S20 [Propionibacterium acnes HL053PA2]
 gi|315080787|gb|EFT52763.1| ribosomal protein S20 [Propionibacterium acnes HL078PA1]
 gi|315084456|gb|EFT56432.1| ribosomal protein S20 [Propionibacterium acnes HL027PA2]
 gi|315085796|gb|EFT57772.1| ribosomal protein S20 [Propionibacterium acnes HL002PA3]
 gi|315088787|gb|EFT60763.1| ribosomal protein S20 [Propionibacterium acnes HL072PA1]
 gi|315093175|gb|EFT65151.1| ribosomal protein S20 [Propionibacterium acnes HL060PA1]
 gi|315096132|gb|EFT68108.1| ribosomal protein S20 [Propionibacterium acnes HL038PA1]
 gi|315098396|gb|EFT70372.1| ribosomal protein S20 [Propionibacterium acnes HL059PA2]
 gi|315101248|gb|EFT73224.1| ribosomal protein S20 [Propionibacterium acnes HL046PA1]
 gi|315103321|gb|EFT75297.1| ribosomal protein S20 [Propionibacterium acnes HL050PA2]
 gi|315105526|gb|EFT77502.1| ribosomal protein S20 [Propionibacterium acnes HL030PA1]
 gi|315108472|gb|EFT80448.1| ribosomal protein S20 [Propionibacterium acnes HL030PA2]
 gi|327326051|gb|EGE67841.1| ribosomal protein S20 [Propionibacterium acnes HL096PA2]
 gi|327327729|gb|EGE69505.1| ribosomal protein S20 [Propionibacterium acnes HL103PA1]
 gi|327332077|gb|EGE73814.1| ribosomal protein S20 [Propionibacterium acnes HL096PA3]
 gi|327443282|gb|EGE89936.1| ribosomal protein S20 [Propionibacterium acnes HL013PA2]
 gi|327446066|gb|EGE92720.1| ribosomal protein S20 [Propionibacterium acnes HL043PA2]
 gi|327447952|gb|EGE94606.1| ribosomal protein S20 [Propionibacterium acnes HL043PA1]
 gi|327450920|gb|EGE97574.1| ribosomal protein S20 [Propionibacterium acnes HL087PA3]
 gi|327453001|gb|EGE99655.1| ribosomal protein S20 [Propionibacterium acnes HL092PA1]
 gi|327453730|gb|EGF00385.1| ribosomal protein S20 [Propionibacterium acnes HL083PA2]
 gi|328753608|gb|EGF67224.1| ribosomal protein S20 [Propionibacterium acnes HL020PA1]
 gi|328754342|gb|EGF67958.1| ribosomal protein S20 [Propionibacterium acnes HL087PA1]
 gi|328754830|gb|EGF68446.1| ribosomal protein S20 [Propionibacterium acnes HL025PA2]
 gi|328760448|gb|EGF74016.1| ribosomal protein S20 [Propionibacterium acnes HL099PA1]
 gi|332675297|gb|AEE72113.1| 30S ribosomal protein S20 [Propionibacterium acnes 266]
          Length = 88

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S++R+++R+   A   G +E AT+A R A   + KA SKG+ H N A+ + S +S
Sbjct: 21 NKAVKSALRTYVRNFRRAAEAGDVEAATKAARVANRQLDKAASKGVIHKNQAANRKSAIS 80

Query: 81 KRLKGI 86
          K+L  +
Sbjct: 81 KKLNSL 86


>gi|302869313|ref|YP_003837950.1| 30S ribosomal protein S20 [Micromonospora aurantiaca ATCC 27029]
 gi|315504212|ref|YP_004083099.1| ribosomal protein s20 [Micromonospora sp. L5]
 gi|302572172|gb|ADL48374.1| ribosomal protein S20 [Micromonospora aurantiaca ATCC 27029]
 gi|315410831|gb|ADU08948.1| ribosomal protein S20 [Micromonospora sp. L5]
          Length = 88

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +R L NKS +SS+++ +R  +EA   G  E+AT   R+A   + K
Sbjct: 1  MANIKSQIKRNRQNEKRRLRNKSVKSSLKTAIRKFHEAAEAGDTEKATVLMREATRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S ++KR+
Sbjct: 61 AASKGVIHSNQAANRKSAIAKRV 83


>gi|26987337|ref|NP_742762.1| 30S ribosomal protein S20 [Pseudomonas putida KT2440]
 gi|104783649|ref|YP_610147.1| 30S ribosomal protein S20 [Pseudomonas entomophila L48]
 gi|148545891|ref|YP_001265993.1| 30S ribosomal protein S20 [Pseudomonas putida F1]
 gi|167031662|ref|YP_001666893.1| 30S ribosomal protein S20 [Pseudomonas putida GB-1]
 gi|170723723|ref|YP_001751411.1| 30S ribosomal protein S20 [Pseudomonas putida W619]
 gi|325272196|ref|ZP_08138619.1| 30S ribosomal protein S20 [Pseudomonas sp. TJI-51]
 gi|38258499|sp|Q88Q95|RS20_PSEPK RecName: Full=30S ribosomal protein S20
 gi|123380787|sp|Q1I4S2|RS20_PSEE4 RecName: Full=30S ribosomal protein S20
 gi|166223972|sp|A5VY49|RS20_PSEP1 RecName: Full=30S ribosomal protein S20
 gi|189044877|sp|B0KM81|RS20_PSEPG RecName: Full=30S ribosomal protein S20
 gi|226695405|sp|B1JF86|RS20_PSEPW RecName: Full=30S ribosomal protein S20
 gi|24981988|gb|AAN66226.1|AE016251_2 ribosomal protein S20 [Pseudomonas putida KT2440]
 gi|95112636|emb|CAK17364.1| 30S ribosomal subunit protein S20 [Pseudomonas entomophila L48]
 gi|148509949|gb|ABQ76809.1| SSU ribosomal protein S20P [Pseudomonas putida F1]
 gi|166858150|gb|ABY96557.1| ribosomal protein S20 [Pseudomonas putida GB-1]
 gi|169761726|gb|ACA75042.1| ribosomal protein S20 [Pseudomonas putida W619]
 gi|313496975|gb|ADR58341.1| RpsT [Pseudomonas putida BIRD-1]
 gi|324102662|gb|EGC00086.1| 30S ribosomal protein S20 [Pseudomonas sp. TJI-51]
          Length = 92

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 1  MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             KGI H N A+R   RL+  +K +  +A
Sbjct: 61 MADKGIIHKNKAARHKGRLNGHIKALKEAA 90


>gi|21221022|ref|NP_626801.1| 30S ribosomal protein S20 [Streptomyces coelicolor A3(2)]
 gi|256787814|ref|ZP_05526245.1| 30S ribosomal protein S20 [Streptomyces lividans TK24]
 gi|289771701|ref|ZP_06531079.1| 30S ribosomal protein S20 [Streptomyces lividans TK24]
 gi|17865608|sp|Q9RDM3|RS20_STRCO RecName: Full=30S ribosomal protein S20
 gi|6714669|emb|CAB66241.1| 30s ribosomal protein S20 [Streptomyces coelicolor A3(2)]
 gi|289701900|gb|EFD69329.1| 30S ribosomal protein S20 [Streptomyces lividans TK24]
          Length = 88

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 3/70 (4%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NKS +SS+++ +R A EA   G +E+ATE  R A   + KA SKG+ H N A+ K S 
Sbjct: 19 LRNKSVKSSLKTAIRKAREAAAAGDVEKATEFQRVASRELDKAVSKGVIHKNQAANKKSA 78

Query: 79 LSKR---LKG 85
          L+++   LKG
Sbjct: 79 LAQKVGALKG 88


>gi|189425167|ref|YP_001952344.1| 30S ribosomal protein S20 [Geobacter lovleyi SZ]
 gi|226736501|sp|B3E3K5|RS20_GEOLS RecName: Full=30S ribosomal protein S20
 gi|189421426|gb|ACD95824.1| ribosomal protein S20 [Geobacter lovleyi SZ]
          Length = 87

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SA K I++  +R   N+ ++S+++++++   EA+     E A  A + A  VI K
Sbjct: 1  MAHHKSAIKRIKQNEKRNARNRHQKSTLKTYIKRVREAVESKDKEAAVAALQVAIPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            +KG+ H   ASR VSRL+K
Sbjct: 61 TATKGVIHKANASRSVSRLTK 81


>gi|326793613|ref|YP_004311433.1| 30S ribosomal protein S20 [Marinomonas mediterranea MMB-1]
 gi|326544377|gb|ADZ89597.1| 30S ribosomal protein S20 [Marinomonas mediterranea MMB-1]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   ++K  R+  +R   N S RS VR++++  + AI  G   EA  A   A S + K
Sbjct: 1  MANSAGSRKRARQAIKRRAHNGSLRSMVRTYLKKVDAAIEAGNQAEAQAAYVAATSNLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H N A+R  SRLS ++K +
Sbjct: 61 AANKGLYHKNKAARHKSRLSAKIKAL 86


>gi|307330493|ref|ZP_07609635.1| ribosomal protein S20 [Streptomyces violaceusniger Tu 4113]
 gi|306883828|gb|EFN14872.1| ribosomal protein S20 [Streptomyces violaceusniger Tu 4113]
          Length = 158

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 21  NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
           NK+ +S +++ +R   EA+  G  E+ATEA R A   + KA SKG+ H N A+ K S ++
Sbjct: 91  NKAVKSELKTAIRRTREAVAAGDAEKATEAARAAGRKLDKAVSKGVLHKNNAANKKSAIA 150

Query: 81  KRLKGI 86
           +++ G+
Sbjct: 151 QQVAGL 156


>gi|313837324|gb|EFS75038.1| ribosomal protein S20 [Propionibacterium acnes HL037PA2]
 gi|314928002|gb|EFS91833.1| ribosomal protein S20 [Propionibacterium acnes HL044PA1]
 gi|314971820|gb|EFT15918.1| ribosomal protein S20 [Propionibacterium acnes HL037PA3]
          Length = 81

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S++R+++R+   A   G +E AT+A R A   + KA SKG+ H N A+ + S +S
Sbjct: 14 NKAVKSALRTYVRNFRRAAEAGDVEAATKAARVANRQLDKAASKGVIHKNQAANRKSAIS 73

Query: 81 KRLKGI 86
          K+L  +
Sbjct: 74 KKLNSL 79


>gi|220904190|ref|YP_002479502.1| 30S ribosomal protein S20 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
 gi|254813107|sp|B8IZ97|RS20_DESDA RecName: Full=30S ribosomal protein S20
 gi|219868489|gb|ACL48824.1| ribosomal protein S20 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+   R   N++ R+ V++ ++    AIT     +A EA   A SV+ K
Sbjct: 1  MANHKSAIKRHRQSVERAGRNRAARTRVKNAIKQVRTAITGSDKAQAGEALVAATSVLSK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG  H   A+RK+SRL++ +  I
Sbjct: 61 AASKGAMHWKKAARKISRLARAVNSI 86


>gi|254472217|ref|ZP_05085617.1| ribosomal protein S20 [Pseudovibrio sp. JE062]
 gi|211958500|gb|EEA93700.1| ribosomal protein S20 [Pseudovibrio sp. JE062]
          Length = 54

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 37 EAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          EAI  G    A EA + A+  I +A +KG+ H N ASRKVSRL+ R+K +
Sbjct: 3  EAIVAGDQTAANEAFKVAQPEIMRASTKGVIHANTASRKVSRLNARIKAL 52


>gi|33593733|ref|NP_881377.1| 30S ribosomal protein S20 [Bordetella pertussis Tohama I]
 gi|33597142|ref|NP_884785.1| 30S ribosomal protein S20 [Bordetella parapertussis 12822]
 gi|33600986|ref|NP_888546.1| 30S ribosomal protein S20 [Bordetella bronchiseptica RB50]
 gi|59798866|sp|Q7VVA6|RS20_BORPE RecName: Full=30S ribosomal protein S20
 gi|59798869|sp|Q7W7G3|RS20_BORPA RecName: Full=30S ribosomal protein S20
 gi|59798871|sp|Q7WKV2|RS20_BORBR RecName: Full=30S ribosomal protein S20
 gi|33563806|emb|CAE43048.1| 30s ribosomal protein s20 [Bordetella pertussis Tohama I]
 gi|33566593|emb|CAE37850.1| 30s ribosomal protein s20 [Bordetella parapertussis]
 gi|33575421|emb|CAE32498.1| 30s ribosomal protein s20 [Bordetella bronchiseptica RB50]
 gi|332383136|gb|AEE67983.1| 30S ribosomal protein S20 [Bordetella pertussis CS]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S RS +R+ ++   ++I  G    A E  RKA SVI  
Sbjct: 1  MANTAQARKRARQSVQRNKHNSSLRSMLRTAIKRVRQSIATGDKAAAGETLRKATSVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 61 VADKNIIHKNKAARHKSRLAAAVKAL 86


>gi|188589456|ref|YP_001920245.1| 30S ribosomal protein S20 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|251779503|ref|ZP_04822423.1| 30S ribosomal protein S20 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
 gi|226736471|sp|B2V2H7|RS20_CLOBA RecName: Full=30S ribosomal protein S20
 gi|188499737|gb|ACD52873.1| 30S ribosomal protein S20 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|243083818|gb|EES49708.1| 30S ribosomal protein S20 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+    +TL N+  +S++++ ++    A+    +EEA  A       +  
Sbjct: 1  MANIKSAKKRIKVTETKTLNNRMVKSALKTVIKKFEAAVAGNNVEEAKTAFVAVTKSLDV 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK SRL+ +L  +
Sbjct: 61 AASKGVVHKNMAARKKSRLAAKLNAM 86


>gi|218294917|ref|ZP_03495771.1| ribosomal protein S20 [Thermus aquaticus Y51MC23]
 gi|218244825|gb|EED11349.1| ribosomal protein S20 [Thermus aquaticus Y51MC23]
          Length = 97

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A      GK EEA +  RKA S+I KA    
Sbjct: 11 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVLLAQEGKAEEAIKIMRKAVSLIDKAAKGS 70

Query: 66 IFHGNAASRKVSRLSKRLKGILTS 89
            H NAA+R+ SRL ++++ +L++
Sbjct: 71 TLHKNAAARRKSRLMRKVQKLLSA 94


>gi|90407182|ref|ZP_01215370.1| putative ribosomal protein S20 [Psychromonas sp. CNPT3]
 gi|90311758|gb|EAS39855.1| putative ribosomal protein S20 [Psychromonas sp. CNPT3]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  RR   N SRR+ +R+F++    AI  G  E AT    K ++++ K
Sbjct: 1  MANIKSAKKRAIQSERRRKHNASRRTMMRTFIKKVVVAIEAGNKEVATTEFVKLQAMLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ + N  +RK SRLS ++K +
Sbjct: 61 FATKGLINKNMVARKKSRLSAKIKAL 86


>gi|282854158|ref|ZP_06263495.1| ribosomal protein S20 [Propionibacterium acnes J139]
 gi|282583611|gb|EFB88991.1| ribosomal protein S20 [Propionibacterium acnes J139]
 gi|314981249|gb|EFT25343.1| ribosomal protein S20 [Propionibacterium acnes HL110PA3]
 gi|315091818|gb|EFT63794.1| ribosomal protein S20 [Propionibacterium acnes HL110PA4]
          Length = 88

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S++R+++R+   A   G +E AT+A R A   + KA SKG+ H N A+ + S +S
Sbjct: 21 NKAVKSALRTYVRNFRRAAEAGDVEAATKAARVANRQLDKAASKGVIHKNQAANRKSAIS 80

Query: 81 KRL 83
          K+L
Sbjct: 81 KKL 83


>gi|329893642|ref|ZP_08269776.1| SSU ribosomal protein S20p [gamma proteobacterium IMCC3088]
 gi|328923569|gb|EGG30881.1| SSU ribosomal protein S20p [gamma proteobacterium IMCC3088]
          Length = 88

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R   N S RS  R+ ++   +AI  G    A EA   A  VI +
Sbjct: 1  MANSPQAKKRARQAEKRRNHNASLRSLGRTVIKKVIKAIDSGDQTSAQEAFGAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRLS ++K +
Sbjct: 61 LADKGIIHKNKAARHKSRLSAKIKAL 86


>gi|300724585|ref|YP_003713910.1| 30S ribosomal subunit protein S20 [Xenorhabdus nematophila ATCC
          19061]
 gi|297631127|emb|CBJ91816.1| 30S ribosomal subunit protein S20 [Xenorhabdus nematophila ATCC
          19061]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI  G  E A  A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASRRSMVRTFIKKVYAAIAAGDKEAAQNAFNNMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L+ ++K +
Sbjct: 61 HACKGLIHKNKAARHKSALAAQIKAM 86


>gi|254447544|ref|ZP_05061010.1| ribosomal protein S20 [gamma proteobacterium HTCC5015]
 gi|198262887|gb|EDY87166.1| ribosomal protein S20 [gamma proteobacterium HTCC5015]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N + RS +R++++    A++ G  E A EA + A+ V+  
Sbjct: 1  MANTIQARKRARQAETRRQHNMALRSRMRTYLKKVQAAVSAGNKEAAQEAFKAAQPVVDG 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR++  +K +
Sbjct: 61 MVNKGLIHKNKAARHKSRMNASIKAL 86


>gi|29832103|ref|NP_826737.1| 30S ribosomal protein S20 [Streptomyces avermitilis MA-4680]
 gi|59798881|sp|Q82BZ4|RS20_STRAW RecName: Full=30S ribosomal protein S20
 gi|29609221|dbj|BAC73272.1| putative ribosomal protein S20 [Streptomyces avermitilis MA-4680]
          Length = 88

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G +E+ATE  R A   + KA SKG+ H N A+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREAAAAGDVEKATEYQRAAARQLDKAVSKGVIHKNQAANKKSA 78

Query: 79 LSKR---LKG 85
          L+ +   LKG
Sbjct: 79 LASKVAPLKG 88


>gi|312898766|ref|ZP_07758155.1| ribosomal protein S20 [Megasphaera micronuciformis F0359]
 gi|310620197|gb|EFQ03768.1| ribosomal protein S20 [Megasphaera micronuciformis F0359]
          Length = 78

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 11 IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
          + K A R   N   +SSV + +R   EAI  G  +   +A  KA SVI  A  KG+ H N
Sbjct: 1  MEKDAARHAANSRVKSSVHTAIRRTTEAIATGDADAVKKAYDKASSVIDSAARKGVLHKN 60

Query: 71 AASRKVSRLSKRL 83
           A+RK SRL+ ++
Sbjct: 61 TAARKKSRLAAKV 73


>gi|289207281|ref|YP_003459347.1| ribosomal protein S20 [Thioalkalivibrio sp. K90mix]
 gi|288942912|gb|ADC70611.1| ribosomal protein S20 [Thioalkalivibrio sp. K90mix]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +    N + RS  R+ M+   + +  G  + A+EA +KA  VI  
Sbjct: 1  MANIASARKRARQAVKNRAHNMALRSRFRTAMKAVLKPLQQGDAQAASEAYKKAVPVIDA 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  SRL+ R++ +
Sbjct: 61 TVSKGLIHRNKAARHKSRLNARIRDL 86


>gi|290474755|ref|YP_003467635.1| 30S ribosomal subunit protein S20 [Xenorhabdus bovienii SS-2004]
 gi|289174068|emb|CBJ80855.1| 30S ribosomal subunit protein S20 [Xenorhabdus bovienii SS-2004]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASRRSMVRTFIKKVYVAIASGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L+ ++K +
Sbjct: 61 HSCKGLIHKNKAARHKSALAAQIKAM 86


>gi|108800476|ref|YP_640673.1| 30S ribosomal protein S20 [Mycobacterium sp. MCS]
 gi|119869614|ref|YP_939566.1| 30S ribosomal protein S20 [Mycobacterium sp. KMS]
 gi|126436099|ref|YP_001071790.1| 30S ribosomal protein S20 [Mycobacterium sp. JLS]
 gi|123069935|sp|Q1B667|RS20_MYCSS RecName: Full=30S ribosomal protein S20
 gi|166223951|sp|A3Q2C2|RS20_MYCSJ RecName: Full=30S ribosomal protein S20
 gi|166223952|sp|A1UIW8|RS20_MYCSK RecName: Full=30S ribosomal protein S20
 gi|108770895|gb|ABG09617.1| SSU ribosomal protein S20P [Mycobacterium sp. MCS]
 gi|119695703|gb|ABL92776.1| SSU ribosomal protein S20P [Mycobacterium sp. KMS]
 gi|126235899|gb|ABN99299.1| SSU ribosomal protein S20P [Mycobacterium sp. JLS]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K IR   RR L N+S +SS+R+ +R   EA+  G  ++A E        + K
Sbjct: 1  MANIKSQEKRIRTNERRRLRNQSVKSSLRTAVRGFREALDAGDKDKAAELLVATSRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG+ H N A+ K S LS
Sbjct: 61 AASKGVIHKNQAANKKSALS 80


>gi|118467555|ref|YP_888840.1| 30S ribosomal protein S20 [Mycobacterium smegmatis str. MC2 155]
 gi|166223950|sp|A0R102|RS20_MYCS2 RecName: Full=30S ribosomal protein S20
 gi|118168842|gb|ABK69738.1| ribosomal protein S20 [Mycobacterium smegmatis str. MC2 155]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K IR   RR L N+S +SS+R+ +R   EA+  G  ++A+E        + K
Sbjct: 1  MANIKSQIKRIRTNERRRLRNQSVKSSLRTAIRGFREAVDAGDKDKASELLHATSRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG+ H N A+ K S L+
Sbjct: 61 AASKGVIHPNQAANKKSALA 80


>gi|307722036|ref|YP_003893176.1| 30S ribosomal protein S20P [Sulfurimonas autotrophica DSM 16294]
 gi|306980129|gb|ADN10164.1| SSU ribosomal protein S20P [Sulfurimonas autotrophica DSM 16294]
          Length = 86

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K IR+   RT  N+  R+ +++ ++  + A+  G  EEA  A + A   I K
Sbjct: 1  MANHKSSIKRIRQTLVRTERNRFYRTRLKNIVKTVSSAVEAGNKEEAQAAFKVANQQIHK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI     A+RKVSRL K +  I
Sbjct: 61 FVSKGILKKETAARKVSRLHKTVNAI 86


>gi|237753219|ref|ZP_04583699.1| 30S ribosomal protein S20 [Helicobacter winghamensis ATCC
          BAA-430]
 gi|229375486|gb|EEO25577.1| 30S ribosomal protein S20 [Helicobacter winghamensis ATCC
          BAA-430]
          Length = 91

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++  R   EAI    + +A E  ++       
Sbjct: 1  MANHKSAEKRIRQTKKRTERNRYYKTRIKNMTRALKEAIDAKDLNKAQETMKQINQNFHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N A+RKVSRL+  +K +
Sbjct: 61 YVSKGILTKNTAARKVSRLNASVKKL 86


>gi|320451144|ref|YP_004203240.1| 30S ribosomal protein S20 [Thermus scotoductus SA-01]
 gi|320151313|gb|ADW22691.1| 30S ribosomal protein S20 [Thermus scotoductus SA-01]
          Length = 97

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A      GK EEA +  R A+S+I KA    
Sbjct: 11 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVLLAQEGKAEEALKIMRMAQSLIDKAAKGS 70

Query: 66 IFHGNAASRKVSRLSKRLKGILTS 89
            H NAASR+ SRL ++++  L++
Sbjct: 71 TLHKNAASRRKSRLMRKVQKYLSA 94


>gi|319957817|ref|YP_004169080.1| SSU ribosomal protein s20p [Nitratifractor salsuginis DSM 16511]
 gi|319420221|gb|ADV47331.1| SSU ribosomal protein S20P [Nitratifractor salsuginis DSM 16511]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK I++  ++T  N+  R+ +++ +R   EA   G  E+A EA + A   +  
Sbjct: 1  MAHHKSAKKRIKQTVKKTERNRYYRTRMKNIIRAVREAAEAGDKEKALEAFKIANKQLHH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG      ASRKVSRL K +  I
Sbjct: 61 YVSKGFLKKQTASRKVSRLHKLVNNI 86


>gi|56421047|ref|YP_148365.1| 30S ribosomal protein S20 [Geobacillus kaustophilus HTA426]
 gi|261418470|ref|YP_003252152.1| 30S ribosomal protein S20 [Geobacillus sp. Y412MC61]
 gi|297529322|ref|YP_003670597.1| ribosomal protein S20 [Geobacillus sp. C56-T3]
 gi|319767569|ref|YP_004133070.1| ribosomal protein S20 [Geobacillus sp. Y412MC52]
 gi|62510980|sp|Q5KWY9|RS20_GEOKA RecName: Full=30S ribosomal protein S20
 gi|56380889|dbj|BAD76797.1| 30S ribosomal protein S20 [Geobacillus kaustophilus HTA426]
 gi|261374927|gb|ACX77670.1| ribosomal protein S20 [Geobacillus sp. Y412MC61]
 gi|297252574|gb|ADI26020.1| ribosomal protein S20 [Geobacillus sp. C56-T3]
 gi|317112435|gb|ADU94927.1| ribosomal protein S20 [Geobacillus sp. Y412MC52]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +   +R   N S +S++R+ ++     +    +E+A EA   A   + K
Sbjct: 1  MANIKSAIKRAKTSEKRRAHNASMKSAMRTAIKKFEALVELKDVEKAREAFIIASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H NAASR+ SRL+K+L  I  S
Sbjct: 61 AASKGLIHKNAASRQKSRLAKKLNSIQAS 89


>gi|327330757|gb|EGE72503.1| ribosomal protein S20 [Propionibacterium acnes HL097PA1]
          Length = 109

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 21  NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
           NK+ +S++R+++R+   A   G +E AT+A R A   + KA SKG+ H N A+ + S +S
Sbjct: 42  NKAVKSALRTYVRNFRRAAEAGDVEAATKAARVANRQLDKAASKGVIHKNQAANRKSAIS 101

Query: 81  KRLKGI 86
           K+L  +
Sbjct: 102 KKLNSL 107


>gi|154506270|ref|ZP_02043008.1| hypothetical protein RUMGNA_03812 [Ruminococcus gnavus ATCC 29149]
 gi|153793409|gb|EDN75829.1| hypothetical protein RUMGNA_03812 [Ruminococcus gnavus ATCC 29149]
          Length = 103

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK I     +   NK+ +S V++ ++    A+    +E A  A + A   I K
Sbjct: 17  LANIKSAKKRILVNETKAAKNKAIKSRVKTSVKKVEAAVAQKDMEAAKTALKAAIGEISK 76

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A SKG++H    SRK+SRL+K + GI
Sbjct: 77  AGSKGVYHKKTVSRKISRLTKAVNGI 102


>gi|88858006|ref|ZP_01132648.1| 30S ribosomal subunit protein S20 [Pseudoalteromonas tunicata D2]
 gi|88819623|gb|EAR29436.1| 30S ribosomal subunit protein S20 [Pseudoalteromonas tunicata D2]
          Length = 86

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F +    AI  G  E A  A   A  V+ +
Sbjct: 1  MANIKSAKKRALTSEKRRQHNASRRSMMRTFFKKVIAAIEAGNKEAAQAAFTVAVPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 YATKGLIHKNKAARHKSRLAAKIKAL 86


>gi|251788186|ref|YP_003002907.1| 30S ribosomal protein S20 [Dickeya zeae Ech1591]
 gi|271502100|ref|YP_003335126.1| 30S ribosomal protein S20 [Dickeya dadantii Ech586]
 gi|247536807|gb|ACT05428.1| ribosomal protein S20 [Dickeya zeae Ech1591]
 gi|270345655|gb|ACZ78420.1| ribosomal protein S20 [Dickeya dadantii Ech586]
          Length = 87

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  S L+ ++  +
Sbjct: 61 QASKGLIHKNKAARHKSNLTAQINAM 86


>gi|304439648|ref|ZP_07399551.1| 30S ribosomal protein S20 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371888|gb|EFM25491.1| 30S ribosomal protein S20 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 87

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    R  L NK+R++  ++ ++   + +  G  +EA E  +  +  ++K
Sbjct: 1  MANIKSAKKRIEIGNRNRLRNKARKTEFKTVIKKFEKTLAEGNFDEAREILKDVDKKLKK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  K + H N A+RK+SRL+KRL
Sbjct: 61 ASVKNVIHKNEAARKISRLTKRL 83


>gi|307132649|ref|YP_003884665.1| 30S ribosomal subunit protein S20 [Dickeya dadantii 3937]
 gi|306530178|gb|ADN00109.1| 30S ribosomal subunit protein S20 [Dickeya dadantii 3937]
          Length = 87

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIASGDKESAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  S L+ ++  +
Sbjct: 61 QASKGLIHKNKAARHKSNLTAQINAM 86


>gi|295399238|ref|ZP_06809220.1| ribosomal protein S20 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110160|ref|YP_003988476.1| ribosomal protein S20 [Geobacillus sp. Y4.1MC1]
 gi|294978704|gb|EFG54300.1| ribosomal protein S20 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215261|gb|ADP73865.1| ribosomal protein S20 [Geobacillus sp. Y4.1MC1]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +   +R   N S +S++R+ ++     +    +E+A EA   A   + K
Sbjct: 1  MANIKSAIKRAKTSEKRRAHNASMKSAMRTAIKKFEAFVELKDVEKAQEAFIIATKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A +KG+ H N ASRK SRL+K+L  I+ S
Sbjct: 61 AVTKGLIHKNTASRKKSRLAKKLNSIIAS 89


>gi|320533501|ref|ZP_08034171.1| ribosomal protein S20 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|325068555|ref|ZP_08127228.1| 30S ribosomal protein S20 [Actinomyces oris K20]
 gi|329946972|ref|ZP_08294384.1| ribosomal protein S20 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|320134287|gb|EFW26565.1| ribosomal protein S20 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|328526783|gb|EGF53796.1| ribosomal protein S20 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 86

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NKS +S +++++R   EA+  G  + A E  + A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNKSVKSELKTYVRRVREAVEAGDKDAALEHLKAASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S+L+KR+
Sbjct: 61 AVSKGVIHKNQAANRKSKLAKRV 83


>gi|322436566|ref|YP_004218778.1| ribosomal protein S20 [Acidobacterium sp. MP5ACTX9]
 gi|321164293|gb|ADW69998.1| ribosomal protein S20 [Acidobacterium sp. MP5ACTX9]
          Length = 93

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 46/84 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K  R+   +T +N++ +S +R  +R   EA+  G   +  +      S++ K
Sbjct: 1  MANHVSSLKRARQTIVKTSLNRANKSKLRGTLRILREALAKGDATDLMKVYSNTASILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          +  KGI H N ASR  SRL+ R+K
Sbjct: 61 SVQKGILHKNTASRYKSRLNARVK 84


>gi|224417847|ref|ZP_03655853.1| 30S ribosomal protein S20 [Helicobacter canadensis MIT 98-5491]
 gi|253827186|ref|ZP_04870071.1| 30S ribosomal protein S20 [Helicobacter canadensis MIT 98-5491]
 gi|313141389|ref|ZP_07803582.1| 30S ribosomal protein S20 [Helicobacter canadensis MIT 98-5491]
 gi|253510592|gb|EES89251.1| 30S ribosomal protein S20 [Helicobacter canadensis MIT 98-5491]
 gi|313130420|gb|EFR48037.1| 30S ribosomal protein S20 [Helicobacter canadensis MIT 98-5491]
          Length = 91

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++  R   EAI    + ++ E  ++       
Sbjct: 1  MANHKSAEKRIRQTKKRTERNRYYKTRIKNMTRSLKEAIEAKDLSKSQEVMKQINQAFHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI   N A+RKVSRL+  +K +
Sbjct: 61 YVSKGILTKNTAARKVSRLNSSVKKL 86


>gi|330469612|ref|YP_004407355.1| 30S ribosomal protein S20 [Verrucosispora maris AB-18-032]
 gi|328812583|gb|AEB46755.1| 30S ribosomal protein S20 [Verrucosispora maris AB-18-032]
          Length = 88

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +R L NKS +SS+++ +R  +EA   G  E+AT   ++A   + K
Sbjct: 1  MANIKSQIKRNRQNEKRRLRNKSVKSSLKTAIRKFHEAAEAGDTEKATVLMQEASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S ++KR+  +
Sbjct: 61 AASKGVIHANQAANRKSAIAKRVASL 86


>gi|320096037|ref|ZP_08027643.1| trigger factor protein [Actinomyces sp. oral taxon 178 str.
          F0338]
 gi|319977031|gb|EFW08768.1| trigger factor protein [Actinomyces sp. oral taxon 178 str.
          F0338]
          Length = 88

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K IR   +R L N++ +S +++ +R   EA+  G  E+A  A R A   +  
Sbjct: 1  MANIKSQIKRIRTNEKRRLRNQAVKSELKTLVRRTREAVEAGDQEKAVAALRVASRKLDV 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S+L++R+
Sbjct: 61 AVSKGVIHKNQAANRKSKLARRV 83


>gi|310643088|ref|YP_003947846.1| 30S ribosomal protein s20 [Paenibacillus polymyxa SC2]
 gi|309248037|gb|ADO57604.1| 30S ribosomal protein S20 [Paenibacillus polymyxa SC2]
          Length = 90

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R  +N S++S++R+ ++ A+ A+   + E A  A + A   + K
Sbjct: 1  MPNIKSAIKRVKTSDKRRALNASQKSALRTAVKAADTALVGNEAEAAAAAFKVASQKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A +KG+ H NAA+RK SRL+K+L  +   A
Sbjct: 61 AVTKGLIHKNAAARKKSRLAKKLNALTAQA 90


>gi|319762106|ref|YP_004126043.1| ribosomal protein s20 [Alicycliphilus denitrificans BC]
 gi|330826063|ref|YP_004389366.1| 30S ribosomal protein S20 [Alicycliphilus denitrificans K601]
 gi|317116667|gb|ADU99155.1| ribosomal protein S20 [Alicycliphilus denitrificans BC]
 gi|329311435|gb|AEB85850.1| ribosomal protein S20 [Alicycliphilus denitrificans K601]
          Length = 99

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 12 RKIARRTL----INKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIF 67
          RK AR+ L     N S RS  R+ +++  +A+  G   +ATE   KA+SV+     KGIF
Sbjct: 17 RKRARQGLKLNAANTSLRSKYRTAVKNVEKAVLAGDKTKATELFAKAQSVLDTIADKGIF 76

Query: 68 HGNAASRKVSRLS 80
          H N A+R  SRLS
Sbjct: 77 HKNKAARDKSRLS 89


>gi|121595315|ref|YP_987211.1| 30S ribosomal protein S20 [Acidovorax sp. JS42]
 gi|222111599|ref|YP_002553863.1| 30S ribosomal protein s20 [Acidovorax ebreus TPSY]
 gi|166200005|sp|A1WA60|RS20_ACISJ RecName: Full=30S ribosomal protein S20
 gi|254813105|sp|B9MCT1|RS20_DIAST RecName: Full=30S ribosomal protein S20
 gi|120607395|gb|ABM43135.1| SSU ribosomal protein S20P [Acidovorax sp. JS42]
 gi|221731043|gb|ACM33863.1| ribosomal protein S20 [Acidovorax ebreus TPSY]
          Length = 100

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 12 RKIARRTL----INKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIF 67
          RK AR+ L     N S RS  R+ +++  +A+  G   +ATE   KA+SV+     KGIF
Sbjct: 17 RKRARQGLKLNAANTSLRSKYRTAVKNVEKAVLAGDKTKATELFAKAQSVLDTIADKGIF 76

Query: 68 HGNAASRKVSRLS 80
          H N A+R  SRLS
Sbjct: 77 HKNKAARDKSRLS 89


>gi|319777672|ref|YP_004137323.1| 30S ribosomal protein s20 [Mycoplasma fermentans M64]
 gi|318038747|gb|ADV34946.1| 30S ribosomal protein S20 [Mycoplasma fermentans M64]
          Length = 91

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I K+    + N + ++ VR  +R A EAI   K + A E   KA S+I  
Sbjct: 1  MANIKSKVKSIAKMEEFRVRNNAMKTRVRKAIRVAREAI-LAKDKNAQELVNKAHSIIAT 59

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A  KG+FH N  +RK SRL K
Sbjct: 60 AVQKGVFHPNKGARKSSRLDK 80


>gi|91789424|ref|YP_550376.1| 30S ribosomal protein S20 [Polaromonas sp. JS666]
 gi|118573830|sp|Q126R4|RS20_POLSJ RecName: Full=30S ribosomal protein S20
 gi|91698649|gb|ABE45478.1| SSU ribosomal protein S20P [Polaromonas sp. JS666]
          Length = 103

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G  ++A +   KA+S++     KG
Sbjct: 15 SGRKRVRQDTKLNAANTSLRSKYRTAVKNVEKAVAAGDKDKAKDLFAKAQSIVDIVADKG 74

Query: 66 IFHGNAASRKVSRLSKRL 83
          IFH N A+R  SRLS ++
Sbjct: 75 IFHKNKAARDKSRLSAKV 92


>gi|120553791|ref|YP_958142.1| ribosomal protein S20 [Marinobacter aquaeolei VT8]
 gi|166223946|sp|A1TYY6|RS20_MARAV RecName: Full=30S ribosomal protein S20
 gi|120323640|gb|ABM17955.1| SSU ribosomal protein S20P [Marinobacter aquaeolei VT8]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS  R++M+  +  I  G  +EA  A ++A+ ++  
Sbjct: 1  MANSPQAKKRARQNEKNRKHNASLRSMARTYMKKVDAKIKAGNHDEAQAALKEAQPIMDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGIF  N  +R  SRL+ ++K +
Sbjct: 61 MVNKGIFAKNKIARHKSRLNAKIKAL 86


>gi|225573011|ref|ZP_03781766.1| hypothetical protein RUMHYD_01202 [Blautia hydrogenotrophica DSM
          10507]
 gi|225039625|gb|EEG49871.1| hypothetical protein RUMHYD_01202 [Blautia hydrogenotrophica DSM
          10507]
          Length = 92

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 4/88 (4%)

Query: 1  MANKDSAKKMIRKIARRTLI--NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
          +AN  SAKK I  +  RT    NK+ +S+V++ ++    A+     E A+ A   A S I
Sbjct: 6  LANIKSAKKRI--LVNRTKAARNKAIKSAVKTSIKKVEAAVAKKDKEAASAALVNAVSTI 63

Query: 59 QKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           KA SKG++H N  +RK+SRL+K +  I
Sbjct: 64 SKATSKGVYHKNNCARKISRLTKAVNSI 91


>gi|152989857|ref|YP_001355579.1| 30S ribosomal protein S20 [Nitratiruptor sp. SB155-2]
 gi|166223957|sp|A6Q163|RS20_NITSB RecName: Full=30S ribosomal protein S20
 gi|151421718|dbj|BAF69222.1| 30S ribosomal protein S20 [Nitratiruptor sp. SB155-2]
          Length = 90

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K +R+  +RT  N+  R+ +++ ++   EA+  G    A EA + A   I +
Sbjct: 1  MANHKSALKRVRQTKKRTERNRFYRTRMKNIIKDVKEAVASGNKAAAIEALKVANKRIHE 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            SKGI   N A+RKVS+L K
Sbjct: 61 YVSKGIIKKNNAARKVSKLHK 81


>gi|154482559|ref|ZP_02025007.1| hypothetical protein EUBVEN_00226 [Eubacterium ventriosum ATCC
          27560]
 gi|149736584|gb|EDM52470.1| hypothetical protein EUBVEN_00226 [Eubacterium ventriosum ATCC
          27560]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +   NK+ +S+V++ ++    A+     E A  A   A  +I+ 
Sbjct: 1  MANIKSAKKRILVNQTKYERNKAAKSAVKTAIKKVEAAVAANDKEAANTALVAATKLIEM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGI+H N  +RK+SRL+K +  +
Sbjct: 61 AGSKGIYHKNNVARKISRLTKLVNTV 86


>gi|288940512|ref|YP_003442752.1| 30S ribosomal protein S20 [Allochromatium vinosum DSM 180]
 gi|288895884|gb|ADC61720.1| ribosomal protein S20 [Allochromatium vinosum DSM 180]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N ++RS++R+F++   +AI     E A +A + A   I +
Sbjct: 1  MANSPQARKRARQAEDRRQRNMAQRSTLRTFIKKVIKAIRAEDKEAAVQAFKDAVPRIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N A+R  SRL+  +K +
Sbjct: 61 AARKGLIHANKAARHKSRLNAHIKAM 86


>gi|308190278|ref|YP_003923209.1| hypothetical protein MFE_07590 [Mycoplasma fermentans JER]
 gi|307625020|gb|ADN69325.1| hypothetical protein MFE_07590 [Mycoplasma fermentans JER]
          Length = 98

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I K+    + N + ++ VR  +R A EAI   K + A E   KA S+I  
Sbjct: 8  MANIKSKVKSIAKMEEFRVRNNAMKTRVRKAIRVAREAI-LAKDKNAQELVNKAHSIIAT 66

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A  KG+FH N  +RK SRL K
Sbjct: 67 AVQKGVFHPNKGARKSSRLDK 87


>gi|255622364|ref|XP_002540275.1| formamidopyrimidine-DNA glycosylase, putative [Ricinus communis]
 gi|223497337|gb|EEF22108.1| formamidopyrimidine-DNA glycosylase, putative [Ricinus communis]
          Length = 223

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN   A+K IR+  RR  IN +R S +R+F++    AI  G    A+ A ++A+  + +
Sbjct: 138 MANTPQARKRIRRNERRAEINTNRVSRIRTFVKKVEAAIAGGDKTAASAALKEAQPELAR 197

Query: 61  AKSKGIFHGNAASRKVSRLSK 81
             ++G+ H N A+RK SRL+K
Sbjct: 198 GVARGVLHKNTAARKFSRLTK 218


>gi|163856989|ref|YP_001631287.1| 30S ribosomal protein S20 [Bordetella petrii DSM 12804]
 gi|226735303|sp|A9IQ52|RS20_BORPD RecName: Full=30S ribosomal protein S20
 gi|163260717|emb|CAP43019.1| 30S ribosomal protein S20 [Bordetella petrii]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N S RS +R+ ++   ++I  G    A+E  +KA SVI +
Sbjct: 1  MANTAQARKRARQSVERNKHNSSLRSMLRTAIKRVRQSIAAGDKAAASEVFQKATSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 61 VADKNIIHKNKAARHKSRLAAAIKAL 86


>gi|28199321|ref|NP_779635.1| 30S ribosomal protein S20 [Xylella fastidiosa Temecula1]
 gi|161378159|ref|NP_299700.2| 30S ribosomal protein S20 [Xylella fastidiosa 9a5c]
 gi|54039475|sp|P66513|RS20_XYLFT RecName: Full=30S ribosomal protein S20
 gi|54042166|sp|P66512|RS20_XYLFA RecName: Full=30S ribosomal protein S20
 gi|28057427|gb|AAO29284.1| 30S ribosomal protein S20 [Xylella fastidiosa Temecula1]
 gi|307578314|gb|ADN62283.1| 30S ribosomal protein S20 [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +++   R   N ++RS +R+ ++   +A++   I  A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRVKQTVVRNERNTAQRSMLRTAVKKVIKALSIKDIAGAETAFAVAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            S+G+ H N A+R  SRL+ R+K + T+
Sbjct: 61 FSSRGLIHKNKAARHKSRLTARIKALKTA 89


>gi|313679538|ref|YP_004057277.1| SSU ribosomal protein s20p [Oceanithermus profundus DSM 14977]
 gi|313152253|gb|ADR36104.1| SSU ribosomal protein S20P [Oceanithermus profundus DSM 14977]
          Length = 96

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 46/86 (53%)

Query: 2  ANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKA 61
          A   SA K  R+  +R   NK+++S +++F + A +A   G  E A    R AES+I KA
Sbjct: 6  ARTPSAMKRHRQSLKRRARNKAKKSMIKTFSKKAVQAAENGDKERALRYLRVAESLIDKA 65

Query: 62 KSKGIFHGNAASRKVSRLSKRLKGIL 87
                H   A+RK SRL KRL  IL
Sbjct: 66 AKGSTLHARTAARKKSRLMKRLHRIL 91


>gi|227548755|ref|ZP_03978804.1| 30S ribosomal protein S20 [Corynebacterium lipophiloflavum DSM
          44291]
 gi|227079167|gb|EEI17130.1| 30S ribosomal protein S20 [Corynebacterium lipophiloflavum DSM
          44291]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN    KK +    +R L NKS RS+ R+ MR   EA+  G    A    R A   + K
Sbjct: 1  MANIKQQKKRVLTNEKRRLRNKSVRSATRTEMRKFREAVESGDKAAAEAQLRVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG+FH NAA+ K S +++ L
Sbjct: 61 AVTKGVFHRNAAANKKSNMARAL 83


>gi|309388915|gb|ADO76795.1| SSU ribosomal protein S20P [Halanaerobium praevalens DSM 2228]
          Length = 86

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SAKK ++  A++T  NK  +  +++ ++   +A+  G  E A E  ++ + VI KA ++ 
Sbjct: 6  SAKKRVKTSAKKTAQNKEWKERLKNAIKTMEKAVETGDKEAAAEQLKETKKVIDKAVTRN 65

Query: 66 IFHGNAASRKVSRLSK 81
          I H N A+RK SRL+K
Sbjct: 66 IIHKNNAARKKSRLTK 81


>gi|123440978|ref|YP_001004967.1| 30S ribosomal protein S20 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|332160243|ref|YP_004296820.1| 30S ribosomal protein S20 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|166224001|sp|A1JJD9|RS20_YERE8 RecName: Full=30S ribosomal protein S20
 gi|122087939|emb|CAL10727.1| 30S ribosomal protein S20 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|318607187|emb|CBY28685.1| SSU ribosomal protein S20p [Yersinia enterocolitica subsp.
          palearctica Y11]
 gi|325664473|gb|ADZ41117.1| 30S ribosomal protein S20 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330863049|emb|CBX73181.1| 30S ribosomal protein S20 [Yersinia enterocolitica W22703]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 44/79 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI  G  + A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMVRTFIKKVYAAIAAGDKDTAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
            SKG+ H N A+R  S L
Sbjct: 61 QSSKGLIHKNKAARHKSNL 79


>gi|220929398|ref|YP_002506307.1| ribosomal protein S20 [Clostridium cellulolyticum H10]
 gi|254813058|sp|B8I3I4|RS20_CLOCE RecName: Full=30S ribosomal protein S20
 gi|219999726|gb|ACL76327.1| ribosomal protein S20 [Clostridium cellulolyticum H10]
          Length = 85

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    +TL N  R+S++++ ++   EAI  G  E  ++A   A   + K
Sbjct: 1  MPNIKSAIKRVKVNEAKTLENTIRKSALKTTIKKCKEAIVTG--ENTSDAYTAATKALDK 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +K I H N A+RK SRL+K L
Sbjct: 59 AAAKNILHKNTAARKKSRLAKAL 81


>gi|227329319|ref|ZP_03833343.1| 30S ribosomal protein S20 [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIAVGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L  R+  +
Sbjct: 61 QAGKGLIHKNKAARHKSNLVARINAM 86


>gi|85058390|ref|YP_454092.1| 30S ribosomal protein S20 [Sodalis glossinidius str. 'morsitans']
 gi|118574558|sp|Q2NVY8|RS20_SODGM RecName: Full=30S ribosomal protein S20
 gi|84778910|dbj|BAE73687.1| 30S ribosomal protein S20 [Sodalis glossinidius str. 'morsitans']
          Length = 87

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A  A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASRRSMMRTFVKKVYAAIAAGDKEAAQNAFSAMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  S L+ ++  +
Sbjct: 61 QASKGLIHKNKAARHKSNLTAQINAM 86


>gi|37524593|ref|NP_927937.1| 30S ribosomal protein S20 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|59798822|sp|Q7N8X4|RS20_PHOLL RecName: Full=30S ribosomal protein S20
 gi|36784017|emb|CAE12884.1| ribosomal protein S20 [Photorhabdus luminescens subsp. laumondii
          TTO1]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKRRKHNASRRSMVRTFIKKVYAAIATGDKEAAQKAFHDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L+ ++  +
Sbjct: 61 HACKGLIHKNKAARHKSNLTAQINAM 86


>gi|78778238|ref|YP_394553.1| 30S ribosomal protein S20 [Sulfurimonas denitrificans DSM 1251]
 gi|118574569|sp|Q30NW3|RS20_SULDN RecName: Full=30S ribosomal protein S20
 gi|78498778|gb|ABB45318.1| SSU ribosomal protein S20P [Sulfurimonas denitrificans DSM 1251]
          Length = 86

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+ K IR+   R+  N+  R+ +++ ++    AIT G  EEA  A   A   IQK
Sbjct: 1  MANHKSSIKRIRQTIVRSERNRFYRTRLKNIVKDVRSAITAGNKEEAASAMGVANKQIQK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+     A+RK+SRL + +  I
Sbjct: 61 FVSKGVLKKETAARKISRLHRAVNAI 86


>gi|254785135|ref|YP_003072563.1| 30S ribosomal protein S20 [Teredinibacter turnerae T7901]
 gi|259494875|sp|C5BQB7|RS20_TERTT RecName: Full=30S ribosomal protein S20
 gi|237683662|gb|ACR10926.1| ribosomal protein S20 [Teredinibacter turnerae T7901]
          Length = 88

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS VR++++    AI  G  E A +A   A  VI +
Sbjct: 1  MANSPQAKKRARQNDKARAHNASLRSMVRTYLKKVVAAIEAGDAEAAKKAYVAAVPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+ ++KG+
Sbjct: 61 MADKGIIHKNKAARHKSRLNAQIKGL 86


>gi|184200953|ref|YP_001855160.1| 30S ribosomal protein S20 [Kocuria rhizophila DC2201]
 gi|226736508|sp|B2GHV1|RS20_KOCRD RecName: Full=30S ribosomal protein S20
 gi|183581183|dbj|BAG29654.1| 30S ribosomal protein S20 [Kocuria rhizophila DC2201]
          Length = 86

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  L N S +S +++ +R  + A+  G  + A E  R A   + K
Sbjct: 1  MANIKSQKKRILTNEKARLRNNSYKSELKTLIRKVDAAVESGNKDAAAETLRTASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ K S L+K++  I
Sbjct: 61 AVSKGVLHKNTAANKKSGLAKKVAKI 86


>gi|302385293|ref|YP_003821115.1| ribosomal protein S20 [Clostridium saccharolyticum WM1]
 gi|302195921|gb|ADL03492.1| ribosomal protein S20 [Clostridium saccharolyticum WM1]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 45/81 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +   NK+ RS V++ ++    AI  G    A      A + I K
Sbjct: 1  MANIKSAKKRILVNETKAARNKAIRSKVKTSIKKVEAAIVAGDKAAAQANLANAIAEIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KG++H N ASRKVSR+SK
Sbjct: 61 AATKGVYHKNTASRKVSRISK 81


>gi|239616693|ref|YP_002940015.1| ribosomal protein S20 [Kosmotoga olearia TBF 19.5.1]
 gi|259494867|sp|C5CD67|RS20_KOSOT RecName: Full=30S ribosomal protein S20
 gi|239505524|gb|ACR79011.1| ribosomal protein S20 [Kosmotoga olearia TBF 19.5.1]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGK-IEEATEACRKAESVIQ 59
          M N  SA K +R+   R L NKS R+  R+  +   +AI   +  E+  E  R + SV+ 
Sbjct: 1  MPNIKSAAKRVRQNKVRRLRNKSVRTRFRNVTKQLLKAIEINEEPEKVNELLRLSYSVLD 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          KA  KG+ H   ASR+ SRL+ ++K  L
Sbjct: 61 KAAKKGVIHKRQASRRKSRLTAKVKAYL 88


>gi|238917137|ref|YP_002930654.1| hypothetical protein EUBELI_01209 [Eubacterium eligens ATCC 27750]
 gi|238872497|gb|ACR72207.1| Hypothetical protein EUBELI_01209 [Eubacterium eligens ATCC 27750]
          Length = 107

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 49/81 (60%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK +     R   NK+ +S V+++++    A+  G    A EA   A + I+K
Sbjct: 21  LANIKSAKKRVITSQVRAERNKAVKSRVKTYIKKVEAAVAAGDKAAANEALPVAIAEIEK 80

Query: 61  AKSKGIFHGNAASRKVSRLSK 81
           A SKGIFH NAA+RKVS ++K
Sbjct: 81  AASKGIFHKNAAARKVSHITK 101


>gi|254501896|ref|ZP_05114047.1| ribosomal protein S20 [Labrenzia alexandrii DFL-11]
 gi|222437967|gb|EEE44646.1| ribosomal protein S20 [Labrenzia alexandrii DFL-11]
          Length = 61

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          +R+++R   EAI  G    A +A + A+  I +A SKG  H N ASRKVSRL+ R+K +
Sbjct: 1  MRTYLRKVEEAIASGDQAAANDAFKAAQPEIMRAASKGTMHANTASRKVSRLNARIKAL 59


>gi|29653736|ref|NP_819428.1| SSU ribosomal protein S20P [Coxiella burnetii RSA 493]
 gi|153207896|ref|ZP_01946473.1| ribosomal protein S20 [Coxiella burnetii 'MSU Goat Q177']
 gi|154706992|ref|YP_001425014.1| 30S ribosomal protein S20 [Coxiella burnetii Dugway 5J108-111]
 gi|161830743|ref|YP_001596331.1| 30S ribosomal protein S20 [Coxiella burnetii RSA 331]
 gi|165918853|ref|ZP_02218939.1| ribosomal protein S20 [Coxiella burnetii RSA 334]
 gi|212213114|ref|YP_002304050.1| 30S ribosomal protein S20 [Coxiella burnetii CbuG_Q212]
 gi|212219171|ref|YP_002305958.1| 30S ribosomal protein S20 [Coxiella burnetii CbuK_Q154]
 gi|59798887|sp|Q83ED6|RS20_COXBU RecName: Full=30S ribosomal protein S20
 gi|189044858|sp|A9KEJ4|RS20_COXBN RecName: Full=30S ribosomal protein S20
 gi|189044859|sp|A9NBL7|RS20_COXBR RecName: Full=30S ribosomal protein S20
 gi|226736477|sp|B6J9J9|RS20_COXB1 RecName: Full=30S ribosomal protein S20
 gi|226736478|sp|B6J1S7|RS20_COXB2 RecName: Full=30S ribosomal protein S20
 gi|29540999|gb|AAO89942.1| SSU ribosomal protein S20P [Coxiella burnetii RSA 493]
 gi|120576322|gb|EAX32946.1| ribosomal protein S20 [Coxiella burnetii 'MSU Goat Q177']
 gi|154356278|gb|ABS77740.1| SSU ribosomal protein S20P [Coxiella burnetii Dugway 5J108-111]
 gi|161762610|gb|ABX78252.1| ribosomal protein S20 [Coxiella burnetii RSA 331]
 gi|165917485|gb|EDR36089.1| ribosomal protein S20 [Coxiella burnetii RSA 334]
 gi|212011524|gb|ACJ18905.1| SSU ribosomal protein S20P [Coxiella burnetii CbuG_Q212]
 gi|212013433|gb|ACJ20813.1| SSU ribosomal protein S20P [Coxiella burnetii CbuK_Q154]
          Length = 90

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +R L N S+RS+VR+ ++   +++       A  A + A  ++ K
Sbjct: 1  MANSAQAKKRARQNEKRELHNASQRSAVRTAVKKILKSLQANDSSAAQSAYQHAVQILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A  + I H N A+R  SRLS+++K + +S
Sbjct: 61 AAGRRIIHPNKAARLKSRLSQKIKNLSSS 89


>gi|323704213|ref|ZP_08115792.1| ribosomal protein S20 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536279|gb|EGB26051.1| ribosomal protein S20 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 88

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    RRTL NK  +S VR+ +    +++  G I+    A   A   + K
Sbjct: 1  MANIKSAKKRILVTKRRTLENKIVKSKVRTAISKFEKSLAEGNIDNTKAALINAIRELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG  H N  +RK SRL  +   +
Sbjct: 61 AYSKGTLHKNTVARKKSRLYAKFNAL 86


>gi|307297250|ref|ZP_07577056.1| ribosomal protein S20 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916510|gb|EFN46892.1| ribosomal protein S20 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 92

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEE-ATEACRKAESVIQ 59
          M N  SAKK +R+ A++T++NK+ R+  R+  +   +AI  G+  +  +    +  S + 
Sbjct: 1  MPNNASAKKRVRQTAKKTMMNKAVRTKFRNASKKLYKAIEEGEDPKLVSSMLSEVYSTLD 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          KA   G  H N ASRK +RL+ ++K  +
Sbjct: 61 KAAKSGTIHKNTASRKKARLTSKVKTYV 88


>gi|314967980|gb|EFT12079.1| ribosomal protein S20 [Propionibacterium acnes HL037PA1]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S++R+++R+       G +E AT+A R A   + KA SKG+ H N A+ + S +S
Sbjct: 21 NKAVKSALRTYVRNFRRGAEAGDVEAATKAARVANRQLDKAASKGVIHKNQAANRKSAIS 80

Query: 81 KRLKGI 86
          K+L  +
Sbjct: 81 KKLNSL 86


>gi|212638670|ref|YP_002315190.1| 30S ribosomal protein S20 [Anoxybacillus flavithermus WK1]
 gi|212560150|gb|ACJ33205.1| Ribosomal protein S20 [Anoxybacillus flavithermus WK1]
          Length = 102

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (55%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SA K  +   +R   N S +S++R+ ++     +    +E+A EA   A   I K
Sbjct: 15  MANIKSAIKRAKTSEKRRAHNASMKSAMRTAIKKFEALVELKDVEKAKEAFAFATKKIDK 74

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A SKG+ H NAA+R  SRL+K+L  I
Sbjct: 75  AASKGLIHKNAANRYKSRLAKKLNSI 100


>gi|46580305|ref|YP_011113.1| 30S ribosomal protein S20 [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120602313|ref|YP_966713.1| 30S ribosomal protein S20 [Desulfovibrio vulgaris DP4]
 gi|59798762|sp|Q72AU4|RS20_DESVH RecName: Full=30S ribosomal protein S20
 gi|166223932|sp|A1VCX0|RS20_DESVV RecName: Full=30S ribosomal protein S20
 gi|46449722|gb|AAS96372.1| ribosomal protein S20 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562542|gb|ABM28286.1| SSU ribosomal protein S20P [Desulfovibrio vulgaris DP4]
 gi|311233712|gb|ADP86566.1| ribosomal protein S20 [Desulfovibrio vulgaris RCH1]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++  +R   N++ R+ +++ ++    A+     E+A  A  +A +V+ K
Sbjct: 1  MANHKSALKRHKQSLKRAARNRAVRTRIKNVIKDVRIALQQQDKEQAATALVQASAVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H   A+RK+SRL+K
Sbjct: 61 AASKGVVHWKTAARKISRLTK 81


>gi|326791213|ref|YP_004309034.1| ribosomal protein S20 [Clostridium lentocellum DSM 5427]
 gi|326541977|gb|ADZ83836.1| ribosomal protein S20 [Clostridium lentocellum DSM 5427]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 47/81 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I  IA +T  N++ +S+V++ ++    A+       A  A   A   I K
Sbjct: 1  MANIKSAKKRILVIATKTARNRAIKSAVKTQIKKVRFAVEANDQAAAKVALVNAVKAIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KGIFH NAA+RK S L++
Sbjct: 61 ATAKGIFHKNAAARKKSSLTR 81


>gi|154509303|ref|ZP_02044945.1| hypothetical protein ACTODO_01828 [Actinomyces odontolyticus ATCC
          17982]
 gi|293189684|ref|ZP_06608401.1| ribosomal protein S20 [Actinomyces odontolyticus F0309]
 gi|153798937|gb|EDN81357.1| hypothetical protein ACTODO_01828 [Actinomyces odontolyticus ATCC
          17982]
 gi|292821422|gb|EFF80364.1| ribosomal protein S20 [Actinomyces odontolyticus F0309]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +R + N+S +S +++ +R   EA+  G  E+A  A R A   +  
Sbjct: 1  MANIKSQKKRILTNEKRRVRNQSVKSELKTLVRRTREAVEAGDKEKALAALRVASRKLDV 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S+L++R+
Sbjct: 61 AVSKGVIHKNQAANRKSKLARRV 83


>gi|163797309|ref|ZP_02191262.1| Ribosomal protein S20p [alpha proteobacterium BAL199]
 gi|159177400|gb|EDP61956.1| Ribosomal protein S20p [alpha proteobacterium BAL199]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK I + A R  IN +R S +R+F++   +AI  G    A  A  +A+  + +
Sbjct: 1  MAHHKSAKKRIVRNAHRFEINHARTSRIRTFVKKVEKAIAAGDHAAARTAFVEAQPEMHR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N  +RK+SR++ R+K +
Sbjct: 61 GVSKGVLHRNTVARKLSRMNARIKAL 86


>gi|225849955|ref|YP_002730189.1| ribosomal protein S20 [Persephonella marina EX-H1]
 gi|254813090|sp|C0QU24|RS20_PERMH RecName: Full=30S ribosomal protein S20
 gi|225645179|gb|ACO03365.1| ribosomal protein S20 [Persephonella marina EX-H1]
          Length = 92

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK IR+  +R L+N+   S +++ ++   EA+    IE A +    A+ +  +
Sbjct: 1  MAHTRSAKKRIRQAEKRRLLNRYHISRMKTAIKRITEALKNKDIETAEKLLPLAQKLAYR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG  H N A+R+VSR+ +++
Sbjct: 61 AAAKGAIHKNEAARRVSRIYRKV 83


>gi|260222998|emb|CBA33124.1| 30S ribosomal protein S20 [Curvibacter putative symbiont of Hydra
          magnipapillata]
          Length = 99

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G   +A E   K ++V+     KG
Sbjct: 15 SGRKRVRQDIKINAANTSLRSKYRTAVKNVEKAVVAGDKTKAAELFAKMQAVVDTVADKG 74

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
          IFH N A+R  SRL+ ++K +  +A
Sbjct: 75 IFHKNKAARDKSRLASKVKALALAA 99


>gi|15806327|ref|NP_295033.1| 30S ribosomal protein S20 [Deinococcus radiodurans R1]
 gi|17865609|sp|Q9RUS3|RS20_DEIRA RecName: Full=30S ribosomal protein S20
 gi|6459060|gb|AAF10881.1|AE001978_1 ribosomal protein S20 [Deinococcus radiodurans R1]
          Length = 92

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K  R+  +R  IN++++S++++F + A  A   G  E+AT   ++AES+I KA    
Sbjct: 7  SAQKRHRQSLKRRAINRAKKSTIKTFSKKALVAAQGG-AEDATAMQQRAESLIDKAAKGS 65

Query: 66 IFHGNAASRKVSRL 79
            H NAA+RK SRL
Sbjct: 66 TLHKNAAARKKSRL 79


>gi|325681056|ref|ZP_08160588.1| ribosomal protein S20 [Ruminococcus albus 8]
 gi|324107285|gb|EGC01569.1| ribosomal protein S20 [Ruminococcus albus 8]
          Length = 83

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK ++ I ++TL NK+ +S +++ ++ A+ A+      +  +  R A   +  
Sbjct: 1  MPNIKSAKKRVKVIEKKTLRNKAIKSDLKTALKKADAAVA-NNASDKEQVVRAAIKKVDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KGI H N A+RK S+L+K+L
Sbjct: 60 ACTKGILHKNNAARKKSQLAKKL 82


>gi|297617824|ref|YP_003702983.1| ribosomal protein S20 [Syntrophothermus lipocalidus DSM 12680]
 gi|297145661|gb|ADI02418.1| ribosomal protein S20 [Syntrophothermus lipocalidus DSM 12680]
          Length = 90

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA   +  K  RK     L N + +S++++ ++    A+    +E A E  +KA SVI K
Sbjct: 1  MAKSKTPAKRARKAEENRLRNAANKSAMKTAIKRFEAALASKDLELAQEKLKKAISVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
             KGI H N A+RK SRL+KR K
Sbjct: 61 NAVKGIIHRNTAARKKSRLAKRFK 84


>gi|331084706|ref|ZP_08333794.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330410800|gb|EGG90222.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +   NK+ +S V+++++    A+       A EA + A   I K
Sbjct: 1  MANIKSAKKRILVNETKAARNKAIKSKVKTYVKKVETAVAHSDKAAAEEALKAAIVEINK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N  +RKVSRL+K + GI
Sbjct: 61 AGSKGVYHKNTCARKVSRLTKAVNGI 86


>gi|163784919|ref|ZP_02179680.1| hypothetical protein HG1285_07727 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879812|gb|EDP73555.1| hypothetical protein HG1285_07727 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 90

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  +A+K +R+  RR L N+   S +R+  +   EA+  G I++A      A+ +  +
Sbjct: 1  MAHTRNARKRVRQAERRRLENRYHISRMRTAFKRIREALKEGDIQKAESLLPLAQKIAYR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KG  H N A+R+VSR ++++
Sbjct: 61 AAAKGAIHKNEAARRVSRYAQKI 83


>gi|291545218|emb|CBL18327.1| SSU ribosomal protein S20P [Ruminococcus sp. 18P13]
          Length = 83

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K ++    +   NK+R+S +++ ++ AN A+  G  +E  EA + A   + +
Sbjct: 1  MANIKSAMKRVKVNKVKAAANKARKSELKTVLKKANLAVESGANKE--EAIKAAIKRVDQ 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A +KG+ H N A+RK ++L+K+L G
Sbjct: 59 ACAKGLLHKNNAARKKAQLAKKLNG 83


>gi|242309129|ref|ZP_04808284.1| 30S ribosomal protein S20 [Helicobacter pullorum MIT 98-5489]
 gi|239524170|gb|EEQ64036.1| 30S ribosomal protein S20 [Helicobacter pullorum MIT 98-5489]
          Length = 91

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++  R   EAI      ++ E  ++       
Sbjct: 1  MANHKSAEKRIRQTKKRTERNRYYKTRIKNMTRSLKEAIEAKDASKSQEVMKQINQAFHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            SKGI   N A+RKVSRL+  +K ++
Sbjct: 61 YVSKGILKKNTAARKVSRLNASVKKLI 87


>gi|210612459|ref|ZP_03289317.1| hypothetical protein CLONEX_01518 [Clostridium nexile DSM 1787]
 gi|210151567|gb|EEA82574.1| hypothetical protein CLONEX_01518 [Clostridium nexile DSM 1787]
          Length = 117

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK I     +   NK+ +S V++ ++  + A+       A EA + A   I  
Sbjct: 31  LANIKSAKKRILVNETKAARNKAIKSRVKTSIKKVDAAVEAKDQAVAVEALKAAIKEINM 90

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
           A SKG++H N  +RKVSRL+K + GI
Sbjct: 91  AGSKGVYHKNTCARKVSRLTKAVNGI 116


>gi|311895987|dbj|BAJ28395.1| putative ribosomal protein S20 [Kitasatospora setae KM-6054]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G+ E+A    R A   + KA SKG+ H N A+ K S 
Sbjct: 19 LRNKAVKSSLKTALRKAREAAAAGETEKAVVLARAASKALDKAVSKGVIHKNQAANKKSA 78

Query: 79 LSKRL 83
          ++KR+
Sbjct: 79 ITKRV 83


>gi|257461133|ref|ZP_05626231.1| ribosomal protein S20 [Campylobacter gracilis RM3268]
 gi|257441507|gb|EEV16652.1| ribosomal protein S20 [Campylobacter gracilis RM3268]
          Length = 90

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +RT  N+  R+ V++  +   EA+    ++ AT+A + A      
Sbjct: 1  MANHKSAEKRARQTIKRTERNRFYRTRVKNITKAVREAVESKDLDAATQALKTANESFHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
            S+G      ASRKVSRL+K +  + T+
Sbjct: 61 FVSRGFLKKQTASRKVSRLAKLVNSLKTA 89


>gi|331089554|ref|ZP_08338453.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|330404922|gb|EGG84460.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +   NK+ +S V++ ++    A+     E A  A R A   I K
Sbjct: 1  MANIKSAKKRILVNETKAARNKAIKSKVKTAVKKVEAAVAAKDAETAKTALRAAIVEISK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H    SRK+SRLSK +  I
Sbjct: 61 AGTKGVYHKKTVSRKISRLSKAVSSI 86


>gi|121608742|ref|YP_996549.1| 30S ribosomal protein S20 [Verminephrobacter eiseniae EF01-2]
 gi|166223999|sp|A1WIS4|RS20_VEREI RecName: Full=30S ribosomal protein S20
 gi|121553382|gb|ABM57531.1| SSU ribosomal protein S20P [Verminephrobacter eiseniae EF01-2]
          Length = 99

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G   +ATE   K ++V+     KG
Sbjct: 15 SGRKRVRQDIKINAANTSLRSKYRTAVKNVEKAVLAGDKTKATEQFAKMQAVVDTVADKG 74

Query: 66 IFHGNAASRKVSRLS 80
          IFH N A+R  SRLS
Sbjct: 75 IFHKNKAARDKSRLS 89


>gi|330839353|ref|YP_004413933.1| 30S ribosomal protein S20 [Selenomonas sputigena ATCC 35185]
 gi|329747117|gb|AEC00474.1| 30S ribosomal protein S20 [Selenomonas sputigena ATCC 35185]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  ++ + ++K  +R   N + +S VR+  RH  +A+  G  +EA    R A   I +
Sbjct: 1  MPNIKASIRSVKKDEKRRAKNAAEKSRVRTASRHVLDAVEAGNADEAKSFLRAACKTIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +  +FH N A+RK SRL++++  +
Sbjct: 61 AAANHVFHKNCAARKKSRLARKVNAM 86


>gi|327399413|ref|YP_004340282.1| 30S ribosomal protein S20 [Hippea maritima DSM 10411]
 gi|327182042|gb|AEA34223.1| 30S ribosomal protein S20 [Hippea maritima DSM 10411]
          Length = 94

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEA-CRKAESVIQ 59
          MAN  SA K +R+  +R + NK+ R+ +++ ++ +   I     +E  EA  ++AE VI+
Sbjct: 1  MANHKSAIKRVRQNKKRYMRNKAYRTRLKNILKKSRMLIEAESDKETVEAQLKEAEKVIR 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKR 82
          K  SKGI H N ASR +S L ++
Sbjct: 61 KICSKGIIHKNKASRLISNLYQK 83


>gi|288555669|ref|YP_003427604.1| 30S ribosomal protein S20 [Bacillus pseudofirmus OF4]
 gi|288546829|gb|ADC50712.1| 30S ribosomal protein S20 [Bacillus pseudofirmus OF4]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R   N + +S++R+ +++    +  G+ E A  A   A   + K
Sbjct: 1  MPNIKSAIKRVKTNDKRRAQNIAVKSALRTAIKNFEAKVEAGEQENAQAAFVDAAKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAASR+ SRL+K+L G+
Sbjct: 61 AANKGLIHKNAASRQKSRLAKKLNGL 86


>gi|253579921|ref|ZP_04857189.1| 30S ribosomal protein S20 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848920|gb|EES76882.1| 30S ribosomal protein S20 [Ruminococcus sp. 5_1_39BFAA]
          Length = 92

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 4/88 (4%)

Query: 1  MANKDSAKKMIRKIARRTLI--NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
          +AN  SAKK I  +  RT    NK+ +S+V++ M+    A+       A  A + A S I
Sbjct: 6  LANIKSAKKRI--LVNRTKAARNKAIKSAVKTSMKKVEAAVANKDKAAAEVALKDAVSTI 63

Query: 59 QKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           KA SKG++H N  +RKV+RL+K +  I
Sbjct: 64 SKATSKGVYHKNNCARKVARLAKAVNSI 91


>gi|313681234|ref|YP_004058972.1| SSU ribosomal protein s20p [Sulfuricurvum kujiense DSM 16994]
 gi|313154094|gb|ADR32772.1| SSU ribosomal protein S20P [Sulfuricurvum kujiense DSM 16994]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K IR+  +RT  N+  R+ +++ ++    A+  G  EEA  A   A + + K
Sbjct: 1  MANHKSALKRIRQTEKRTERNRFYRTRIKNIVKAVRAAVDAGNKEEAQAALVIANANLHK 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
            SKGI     A+RKVSRL
Sbjct: 61 YVSKGILKKETAARKVSRL 79


>gi|298485389|ref|ZP_07003479.1| SSU ribosomal protein S20p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160087|gb|EFI01118.1| SSU ribosomal protein S20p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 105

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 49/90 (54%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK  ++  +R   N S RS VR+++++  +AI     E+A  A   A  VI +
Sbjct: 14  VANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDR 73

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
              KGI H N A+R   RL+  +K +  +A
Sbjct: 74  MADKGIIHKNKAARHKGRLNGHIKALSLAA 103


>gi|227114258|ref|ZP_03827914.1| 30S ribosomal protein S20 [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L  R+  +
Sbjct: 61 QAGKGLIHKNKAARHKSNLVARINAM 86


>gi|227486716|ref|ZP_03917032.1| 30S ribosomal protein S20 [Anaerococcus lactolyticus ATCC 51172]
 gi|227235304|gb|EEI85319.1| 30S ribosomal protein S20 [Anaerococcus lactolyticus ATCC 51172]
          Length = 85

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S++K I    R  L NK+R+S ++++++     +  G ++EA E  +  +  +++
Sbjct: 1  MANIKSSQKRIEVAKRNNLRNKARKSEIKTYIKKFEALVEAGNLDEAREIFKVVDKKLKQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A+SK + H N  +   S+L+K+L
Sbjct: 61 AESKNVIHKNRVAATASKLAKKL 83


>gi|241766167|ref|ZP_04764072.1| ribosomal protein S20 [Acidovorax delafieldii 2AN]
 gi|241363772|gb|EER59121.1| ribosomal protein S20 [Acidovorax delafieldii 2AN]
          Length = 99

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G   +ATE   K ++V+     KG
Sbjct: 15 SGRKRVRQDIKINAANTSLRSKYRTAVKNVEKAVLAGDKTKATELFAKMQAVVDTVADKG 74

Query: 66 IFHGNAASRKVSRLS 80
          IFH N A+R  SRLS
Sbjct: 75 IFHKNKAARDKSRLS 89


>gi|315604670|ref|ZP_07879733.1| trigger factor [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315313682|gb|EFU61736.1| trigger factor [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 88

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +R + N+S +S +++ +R   EA+  G  ++A  A R A   +  
Sbjct: 1  MANIKSQKKRILTNEKRRVRNQSVKSELKTLVRQTREAVEAGDKDKALAALRVASRKLDV 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S+L++R+
Sbjct: 61 AVSKGVIHKNQAANRKSKLARRV 83


>gi|187934486|ref|YP_001885084.1| 30S ribosomal protein S20 [Clostridium botulinum B str. Eklund
          17B]
 gi|226736472|sp|B2TLY9|RS20_CLOBB RecName: Full=30S ribosomal protein S20
 gi|187722639|gb|ACD23860.1| 30S ribosomal protein S20 [Clostridium botulinum B str. Eklund
          17B]
          Length = 87

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+    +TL N+  +S++++ ++    A+    +EEA          +  
Sbjct: 1  MANIKSAKKRIKVTETKTLNNRMIKSALKTVIKKFEAAVAGNNVEEAKTVFVAVTKSLDV 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK SRL+ +L  +
Sbjct: 61 AASKGVVHKNMAARKKSRLAAKLNAM 86


>gi|124268211|ref|YP_001022215.1| 30S ribosomal protein S20 [Methylibium petroleiphilum PM1]
 gi|166223947|sp|A2SK91|RS20_METPP RecName: Full=30S ribosomal protein S20
 gi|124260986|gb|ABM95980.1| SSU ribosomal protein S20P [Methylibium petroleiphilum PM1]
          Length = 97

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  R    N S RS  R+ ++   +A+  G   +A E  + A+ VI     KG
Sbjct: 15 SGRKRVRQDVRLNAANTSLRSKFRTAIKGVLKAVATGDKAKAGETFKSAQKVIDSIADKG 74

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          +FH N A+R  SRLS ++K +
Sbjct: 75 LFHKNKAARYKSRLSAKIKAL 95


>gi|149911431|ref|ZP_01900048.1| Ribosomal protein S20 [Moritella sp. PE36]
 gi|149805462|gb|EDM65469.1| Ribosomal protein S20 [Moritella sp. PE36]
          Length = 82

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS +R+  +    AI  G  EEAT A   A+ ++ +   KG+ H N A+R  SRL 
Sbjct: 17 NTSRRSMMRTLTKKIIVAIAAGNKEEATAAFITAQPILDRMACKGLIHANKAARIKSRLC 76

Query: 81 KRLKGI 86
           ++K I
Sbjct: 77 AKIKAI 82


>gi|27363974|ref|NP_759502.1| 30S ribosomal protein S20 [Vibrio vulnificus CMCP6]
 gi|161486656|ref|NP_933477.2| 30S ribosomal protein S20 [Vibrio vulnificus YJ016]
 gi|320157352|ref|YP_004189731.1| 30S ribosomal protein S20p [Vibrio vulnificus MO6-24/O]
 gi|31340416|sp|Q8DES4|RS20_VIBVU RecName: Full=30S ribosomal protein S20
 gi|59798814|sp|Q7MNN1|RS20_VIBVY RecName: Full=30S ribosomal protein S20
 gi|27360091|gb|AAO09029.1| ribosomal protein S20 [Vibrio vulnificus CMCP6]
 gi|319932664|gb|ADV87528.1| SSU ribosomal protein S20p [Vibrio vulnificus MO6-24/O]
          Length = 86

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR + ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAQIKAL 86


>gi|229822875|ref|ZP_04448945.1| hypothetical protein GCWU000282_00165 [Catonella morbi ATCC
          51271]
 gi|229787688|gb|EEP23802.1| hypothetical protein GCWU000282_00165 [Catonella morbi ATCC
          51271]
          Length = 91

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK IR+ A +T  N++  S++R+ ++    A+  G+     E  R A   I  
Sbjct: 7  MANNPSAKKRIRQTATKTESNRAHVSAMRTAVKRFRSAVEAGE-SNVEELFRLAAKEIDS 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A +KG+ H N A+R  SRL++ LK 
Sbjct: 66 AATKGLIHKNKAARDKSRLARLLKA 90


>gi|311107331|ref|YP_003980184.1| 30S ribosomal protein S20 [Achromobacter xylosoxidans A8]
 gi|310762020|gb|ADP17469.1| ribosomal protein S20 [Achromobacter xylosoxidans A8]
          Length = 99

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N S RS +R+ ++   ++I  G    A E  +KA SVI +
Sbjct: 13 MANTAQARKRARQSVERNKHNSSLRSMLRTAIKRVRQSIAAGDKAAAGEVFQKASSVIDR 72

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 73 VADKNIIHKNKAARHKSRLAAAIKAL 98


>gi|163803541|ref|ZP_02197410.1| 30S ribosomal protein S20 [Vibrio sp. AND4]
 gi|159172676|gb|EDP57529.1| 30S ribosomal protein S20 [Vibrio sp. AND4]
          Length = 86

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKEAATAAFAAVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR + ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRFTAQIKAL 86


>gi|89895891|ref|YP_519378.1| 30S ribosomal protein S20 [Desulfitobacterium hafniense Y51]
 gi|219670321|ref|YP_002460756.1| 30S ribosomal protein S20 [Desulfitobacterium hafniense DCB-2]
 gi|118573817|sp|Q24SQ8|RS20_DESHY RecName: Full=30S ribosomal protein S20
 gi|254813106|sp|B8FUQ0|RS20_DESHD RecName: Full=30S ribosomal protein S20
 gi|89335339|dbj|BAE84934.1| 30S ribosomal protein S20 [Desulfitobacterium hafniense Y51]
 gi|219540581|gb|ACL22320.1| ribosomal protein S20 [Desulfitobacterium hafniense DCB-2]
          Length = 90

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +     RT+ N + +S++R+ +R   E+++    E A  A  KA   + K
Sbjct: 1  MPNIKSAIKRVEIAKVRTIKNAAAKSTLRTTIRRFEESLSTD-AETAKLALNKATRALDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKR 82
          A SKG+ H N A+RK SRL+KR
Sbjct: 60 ASSKGLVHKNTAARKKSRLTKR 81


>gi|302671375|ref|YP_003831335.1| ribosomal protein S20 RpsT [Butyrivibrio proteoclasticus B316]
 gi|302395848|gb|ADL34753.1| ribosomal protein S20 RpsT [Butyrivibrio proteoclasticus B316]
          Length = 87

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/85 (45%), Positives = 52/85 (61%), Gaps = 8/85 (9%)

Query: 1  MANKDSAKKMI----RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAES 56
          MAN  SAKK I    +K AR  +I    +S+V++ ++    AI  G  EEA +A   A S
Sbjct: 1  MANIKSAKKRILVNEKKAARNQMI----KSAVKTEIKKVRTAIEAGNKEEAAKALLAATS 56

Query: 57 VIQKAKSKGIFHGNAASRKVSRLSK 81
           I KA+SKG+F  N ASRKVSRL++
Sbjct: 57 AIDKAESKGVFKKNTASRKVSRLAQ 81


>gi|261367262|ref|ZP_05980145.1| ribosomal protein S20 [Subdoligranulum variabile DSM 15176]
 gi|282570864|gb|EFB76399.1| ribosomal protein S20 [Subdoligranulum variabile DSM 15176]
          Length = 88

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 3/83 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE-SVIQ 59
          M N  S K  + +  +  + NK+ +S++++ ++ A+ AI     ++  +A  KA  S I 
Sbjct: 1  MPNIKSQKDRVVQAKKEAMHNKAIKSNLKTVIKKADAAIDSNAADK--DAVMKAAVSAID 58

Query: 60 KAKSKGIFHGNAASRKVSRLSKR 82
           AKSKG+ H N A+RKVSR++KR
Sbjct: 59 SAKSKGVIHKNTAARKVSRMAKR 81


>gi|114331657|ref|YP_747879.1| ribosomal protein S20 [Nitrosomonas eutropha C91]
 gi|122313571|sp|Q0AFG8|RS20_NITEC RecName: Full=30S ribosomal protein S20
 gi|114308671|gb|ABI59914.1| SSU ribosomal protein S20P [Nitrosomonas eutropha C91]
          Length = 87

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK +R+  ++   N   RS +R+ ++   +AI  G    A    RK+ S+I  
Sbjct: 1  MANTAQAKKRVRQNIKQRERNSGLRSRLRTAIKSVRKAIVAGDKNLAETVFRKSVSIIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI H N ASR  SRLS  +K +
Sbjct: 61 IASKGIIHKNKASRHKSRLSGAVKAM 86


>gi|153813166|ref|ZP_01965834.1| hypothetical protein RUMOBE_03582 [Ruminococcus obeum ATCC 29174]
 gi|149830697|gb|EDM85788.1| hypothetical protein RUMOBE_03582 [Ruminococcus obeum ATCC 29174]
          Length = 112

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 50/88 (56%), Gaps = 4/88 (4%)

Query: 1   MANKDSAKKMIRKIARRTLI--NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
           +AN  SAKK I  +  RT    NKS RS+V++ ++    A+       A  A  +A S I
Sbjct: 26  LANIKSAKKRI--LVNRTKAARNKSIRSAVKTSIKKVETAVQKNDKAAAQAALTEAISTI 83

Query: 59  QKAKSKGIFHGNAASRKVSRLSKRLKGI 86
            KA SKG++H N  +RK+SRLSK +  I
Sbjct: 84  SKATSKGVYHKNNCARKISRLSKAVNSI 111


>gi|317407677|gb|EFV87613.1| 30S ribosomal protein S20 [Achromobacter xylosoxidans C54]
          Length = 99

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N S RS +R+ ++   ++I  G    A E  +KA SVI +
Sbjct: 13 MANTAQARKRARQSVERNKHNSSLRSMLRTAIKRVRQSIAAGDKAAAGEVFQKASSVIDR 72

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 73 VADKNIIHKNKAARHKSRLAAAIKAL 98


>gi|300780678|ref|ZP_07090533.1| 30S ribosomal protein S20 [Corynebacterium genitalium ATCC 33030]
 gi|300533664|gb|EFK54724.1| 30S ribosomal protein S20 [Corynebacterium genitalium ATCC 33030]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN    KK +    +R   NK+ RS+VR+ +R  NE +  G    A E  R A   + K
Sbjct: 1  MANIKQQKKRVLTNEKRRQRNKAVRSAVRTEIRKFNETVEAGDKAGAEEQLRVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+FH N A+ K S +++ L
Sbjct: 61 AVSKGVFHRNNAANKKSNMARAL 83


>gi|33862043|ref|NP_893604.1| 30S ribosomal protein S20 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|59798834|sp|Q7TU38|RS20_PROMP RecName: Full=30S ribosomal protein S20
 gi|33634261|emb|CAE19946.1| 30s Ribosomal protein S20 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
          Length = 97

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SAKK I+   R  L+NKS +S+VR+  +         K E  ++       +  +
Sbjct: 1  MANNKSAKKRIQVAERNRLVNKSYKSTVRTLTKKTLANCEKYKQEPNSDNKDLVLVSVNQ 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A S+I KA  K + H N  + K S+++K +K  LTS
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANKKSKINKVVKDFLTS 96


>gi|253690016|ref|YP_003019206.1| ribosomal protein S20 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261823083|ref|YP_003261189.1| 30S ribosomal protein S20 [Pectobacterium wasabiae WPP163]
 gi|259494870|sp|C6DF06|RS20_PECCP RecName: Full=30S ribosomal protein S20
 gi|251756594|gb|ACT14670.1| ribosomal protein S20 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261607096|gb|ACX89582.1| ribosomal protein S20 [Pectobacterium wasabiae WPP163]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKEVAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L  R+  +
Sbjct: 61 QAGKGLIHKNKAARHKSNLVARINAM 86


>gi|300853976|ref|YP_003778960.1| putative 30S ribosomal protein S20 [Clostridium ljungdahlii DSM
          13528]
 gi|300434091|gb|ADK13858.1| predicted 30S ribosomal protein S20 [Clostridium ljungdahlii DSM
          13528]
          Length = 88

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 48/83 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ I  +TL NK  +SS+++ ++    ++    +EEA      A   +  
Sbjct: 1  MANIKSAKKRIKVIETKTLRNKIIKSSLKTTIKKFLASVETKNVEEAKVNFTAAVKALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A+SKGI H N ASR  S+L+ +L
Sbjct: 61 AESKGIIHKNKASRNKSKLAFKL 83


>gi|170725649|ref|YP_001759675.1| 30S ribosomal protein S20 [Shewanella woodyi ATCC 51908]
 gi|226695420|sp|B1KIT2|RS20_SHEWM RecName: Full=30S ribosomal protein S20
 gi|169810996|gb|ACA85580.1| ribosomal protein S20 [Shewanella woodyi ATCC 51908]
          Length = 88

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +RS+++    AI  G    ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRSYVKKVIAAIQAGDHAAATEAFNAAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +RL+ R+K +
Sbjct: 61 MATKGLIHKNKAARHKARLNTRIKAL 86


>gi|77166483|ref|YP_345008.1| ribosomal protein S20p [Nitrosococcus oceani ATCC 19707]
 gi|115305694|sp|Q3J6R8|RS20_NITOC RecName: Full=30S ribosomal protein S20
 gi|76884797|gb|ABA59478.1| SSU ribosomal protein S20P [Nitrosococcus oceani ATCC 19707]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R + N  +RS +R++++   +AI  G   +A  A ++A  ++ +
Sbjct: 1  MANTSQARKRARQAGVRRVRNAGQRSMMRTYVKKIVKAIVSGDKSQAAAAYKEAVPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  SRL+ +++ +
Sbjct: 61 LARKGLVHPNKAARHKSRLNAQIRAM 86


>gi|218899490|ref|YP_002447901.1| ribosomal protein S20 [Bacillus cereus G9842]
 gi|226735295|sp|B7IYH5|RS20_BACC2 RecName: Full=30S ribosomal protein S20
 gi|218545504|gb|ACK97898.1| ribosomal protein S20 [Bacillus cereus G9842]
 gi|326942105|gb|AEA18001.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          chinensis CT-43]
          Length = 85

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +    R   N S +S +RS ++     +T   +E A EA + A   + K
Sbjct: 1  MANIKSAIKRAKLSEERRAHNASIKSDMRSAVKTVEALVTNNDLENAKEAFKTASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H NAASR+ SRL+K++
Sbjct: 61 AARKGLIHQNAASRQKSRLAKQV 83


>gi|28897305|ref|NP_796910.1| 30S ribosomal protein S20 [Vibrio parahaemolyticus RIMD 2210633]
 gi|91227673|ref|ZP_01261950.1| 30S ribosomal protein S20 [Vibrio alginolyticus 12G01]
 gi|260363894|ref|ZP_05776642.1| ribosomal protein S20 [Vibrio parahaemolyticus K5030]
 gi|260876268|ref|ZP_05888623.1| ribosomal protein S20 [Vibrio parahaemolyticus AN-5034]
 gi|260897571|ref|ZP_05906067.1| ribosomal protein S20 [Vibrio parahaemolyticus Peru-466]
 gi|262395191|ref|YP_003287045.1| 30S ribosomal protein S20p [Vibrio sp. Ex25]
 gi|269966611|ref|ZP_06180692.1| 30S ribosomal protein S20 [Vibrio alginolyticus 40B]
 gi|31340398|sp|Q87S93|RS20_VIBPA RecName: Full=30S ribosomal protein S20
 gi|28805514|dbj|BAC58794.1| ribosomal protein S20 [Vibrio parahaemolyticus RIMD 2210633]
 gi|91188452|gb|EAS74746.1| 30S ribosomal protein S20 [Vibrio alginolyticus 12G01]
 gi|262338785|gb|ACY52580.1| SSU ribosomal protein S20p [Vibrio sp. Ex25]
 gi|269828796|gb|EEZ83049.1| 30S ribosomal protein S20 [Vibrio alginolyticus 40B]
 gi|308084912|gb|EFO34607.1| ribosomal protein S20 [Vibrio parahaemolyticus Peru-466]
 gi|308093030|gb|EFO42725.1| ribosomal protein S20 [Vibrio parahaemolyticus AN-5034]
 gi|308112974|gb|EFO50514.1| ribosomal protein S20 [Vibrio parahaemolyticus K5030]
 gi|328472067|gb|EGF42944.1| 30S ribosomal protein S20 [Vibrio parahaemolyticus 10329]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR + ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAQIKAL 86


>gi|256825555|ref|YP_003149515.1| 30S ribosomal protein S20P [Kytococcus sedentarius DSM 20547]
 gi|256688948|gb|ACV06750.1| SSU ribosomal protein S20P [Kytococcus sedentarius DSM 20547]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK +   A+RT  N++ +S +R+++R    A   G    A +A + A   + K
Sbjct: 1  MANIKSQKKRVLTNAKRTERNRAYKSELRTWIRKFRAAAESGDATAAQDALQTASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKR 82
          A SKG+ H N A+ K S ++KR
Sbjct: 61 AVSKGVIHKNQAANKKSAMAKR 82


>gi|227488361|ref|ZP_03918677.1| ribosomal protein S20 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227542973|ref|ZP_03973022.1| ribosomal protein S20 [Corynebacterium glucuronolyticum ATCC
          51866]
 gi|227091575|gb|EEI26887.1| ribosomal protein S20 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227181195|gb|EEI62167.1| ribosomal protein S20 [Corynebacterium glucuronolyticum ATCC
          51866]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN    KK ++   +R + N + RS+V++ +R   E +  G+ ++A E  R A   + K
Sbjct: 1  MANIKQQKKRVKTNEKRRVRNMAVRSAVKTEIRKFRELVAAGEKDKAEEQLRVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KG++H N+A+ K SR++K
Sbjct: 61 AVTKGVYHRNSAANKKSRMAK 81


>gi|72382856|ref|YP_292211.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. NATL2A]
 gi|124026593|ref|YP_001015708.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. NATL1A]
 gi|115305699|sp|Q46J20|RS20_PROMT RecName: Full=30S ribosomal protein S20
 gi|166223966|sp|A2C4N4|RS20_PROM1 RecName: Full=30S ribosomal protein S20
 gi|72002706|gb|AAZ58508.1| SSU ribosomal protein S20P [Prochlorococcus marinus str. NATL2A]
 gi|123961661|gb|ABM76444.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. NATL1A]
          Length = 98

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 50/96 (52%), Gaps = 11/96 (11%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN +SAKK I+   R  L NK+ +S+VR+ M+    A    + E   E+  KA+     
Sbjct: 1  MANTNSAKKRIQIAERNRLENKNYKSTVRTLMKRCFVACGIFEKEPGDES--KADLQKTF 58

Query: 56 ----SVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
              S I KA  KG+ H N  + + SRLS  LK +L
Sbjct: 59 NLAFSKIDKAVKKGVLHKNTGANQKSRLSVALKKVL 94


>gi|114778364|ref|ZP_01453211.1| ribosomal protein S20 [Mariprofundus ferrooxydans PV-1]
 gi|114551327|gb|EAU53884.1| ribosomal protein S20 [Mariprofundus ferrooxydans PV-1]
          Length = 95

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 53/86 (61%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SA K  R+  ++ + N++++S++R+ ++    A+  G  + A++A ++A S++ +
Sbjct: 9  VANHVSALKRARQDQKKRIQNRAQKSAMRTAVKQVLVAVEAGDKQAASDALKQATSLLDR 68

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  K   H   ASR+VSRL+  +K I
Sbjct: 69 AGRKNQMHPRQASRRVSRLNAHVKAI 94


>gi|21672434|ref|NP_660501.1| 30S ribosomal protein S20 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25009184|sp|Q8K9Z0|RS20_BUCAP RecName: Full=30S ribosomal protein S20
 gi|21623046|gb|AAM67712.1| 30S ribosomal protein S20 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query: 1  MANKDSAKK--MIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
          MAN  SAKK  +I +  R+   N S+RS +R+F++    AI+ G  E++ +A +K + +I
Sbjct: 1  MANIKSAKKDSIISEERRKK--NASQRSKMRTFIKKVRLAISSGDKEKSYDAFKKMQPII 58

Query: 59 QKAKSKGIFHGNAASRKVSRLS 80
           K  +KG+ H N A+R  S LS
Sbjct: 59 DKYATKGLIHKNKAARYKSILS 80


>gi|206889760|ref|YP_002249071.1| ribosomal protein S20 [Thermodesulfovibrio yellowstonii DSM
          11347]
 gi|206741698|gb|ACI20755.1| ribosomal protein S20 [Thermodesulfovibrio yellowstonii DSM
          11347]
          Length = 102

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S  K IR+ A+R L N++ ++ +++ ++   E I     +       +A  VI KA SKG
Sbjct: 14 SVLKRIRQDAKRRLRNQAWKTKIKTCIKKVEETIAQNNKDSIQAVLNEAIKVISKAASKG 73

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
          I H N ASRK+SRL+K+   +L S+
Sbjct: 74 IIHKNTASRKISRLTKKANTVLISS 98


>gi|255994121|ref|ZP_05427256.1| ribosomal protein S20 [Eubacterium saphenum ATCC 49989]
 gi|255993789|gb|EEU03878.1| ribosomal protein S20 [Eubacterium saphenum ATCC 49989]
          Length = 85

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+ IA++T  N   +  ++   +  NEA+T G  + A E     E  + K
Sbjct: 1  MANIKSAKKRIQVIAKKTAKNNRIKHKLKDMTKEFNEAVTAGDKKIAGEKLLDLEKKLMK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A S G  H   A+RK+SRL+
Sbjct: 61 A-SHGFMHKKTAARKISRLT 79


>gi|269962526|ref|ZP_06176874.1| 30S ribosomal protein S20 [Vibrio harveyi 1DA3]
 gi|269832721|gb|EEZ86832.1| 30S ribosomal protein S20 [Vibrio harveyi 1DA3]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKEAATAAFAAVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR + ++K +
Sbjct: 61 MATKGLVHKNKAARHKSRFAAQIKAL 86


>gi|124516138|gb|EAY57646.1| ribosomal protein S20 [Leptospirillum rubarum]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  +  K I+K  +R   N+   S +R+  +     ++ GK EEA  A  +   VI  
Sbjct: 1  MASHKATLKDIKKNEKRRTRNRQAVSMIRTMAKKVETLVSQGKKEEAVVALGEVVPVIDH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++ I H N+ASRK+SRL+ ++ G+
Sbjct: 61 AVNRRILHRNSASRKISRLTLKVNGL 86


>gi|172056814|ref|YP_001813274.1| 30S ribosomal protein S20 [Exiguobacterium sibiricum 255-15]
 gi|226736497|sp|B1YKS4|RS20_EXIS2 RecName: Full=30S ribosomal protein S20
 gi|171989335|gb|ACB60257.1| ribosomal protein S20 [Exiguobacterium sibiricum 255-15]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K ++   +R + N  R+SS+RS ++      T G  E+A  A   A   I K
Sbjct: 1  MANIKSAIKRVKTAEKRRVANVQRKSSMRSAIKAVETFATEGNKEQALVAFNTASKKIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N A R  SRL++ +  +
Sbjct: 61 AAAKGLIHSNKAGRDKSRLARLVNAL 86


>gi|322383623|ref|ZP_08057374.1| 30S ribosomal protein S20-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
 gi|321151835|gb|EFX44778.1| 30S ribosomal protein S20-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
          Length = 78

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L N S++S +R+ ++     +    ++ A EA   A   + KA SKG+ H N A+RK
Sbjct: 4  KRRLRNASQKSDLRTAIKAFETVVASNNVDSAKEAFVVASKKLDKAASKGLIHKNVANRK 63

Query: 76 VSRLSKRLKGILTSA 90
           SRL+K+L  ++  A
Sbjct: 64 KSRLAKKLNELVAQA 78


>gi|260584666|ref|ZP_05852412.1| 30S ribosomal protein S20 [Granulicatella elegans ATCC 700633]
 gi|260157689|gb|EEW92759.1| 30S ribosomal protein S20 [Granulicatella elegans ATCC 700633]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S  K +R   + TL N S+ S++R+ ++    A+  G  E A E  R A   I  
Sbjct: 1  MPNIASQIKRVRTNKKSTLANNSQTSAMRTAIKKFEAAVAEG-AENAEELLRAAHKAIDG 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N ASR  SRL+ +L
Sbjct: 60 AASKGLIHKNKASRDKSRLASKL 82


>gi|320529870|ref|ZP_08030947.1| ribosomal protein S20 [Selenomonas artemidis F0399]
 gi|320137888|gb|EFW29793.1| ribosomal protein S20 [Selenomonas artemidis F0399]
          Length = 91

 Score = 43.9 bits (102), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 11 IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
          ++  A+R   N + ++ VR  +R  N+A+  G  +EA      A   I +A +  ++H N
Sbjct: 14 VKSDAKRHARNVAEKTRVRRAIRSVNDAVAAGNADEAKNLLVAAYKSIDQAAANNVYHKN 73

Query: 71 AASRKVSRLSKRLKGI 86
          AA+RK SRL+K++  +
Sbjct: 74 AAARKKSRLAKKVNAL 89


>gi|323497793|ref|ZP_08102807.1| 30S ribosomal protein S20 [Vibrio sinaloensis DSM 21326]
 gi|323317140|gb|EGA70137.1| 30S ribosomal protein S20 [Vibrio sinaloensis DSM 21326]
          Length = 86

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKEAATAAFAAVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR S  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFSAAIKAL 86


>gi|15616771|ref|NP_239983.1| 30S ribosomal protein S20 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219681526|ref|YP_002467911.1| 30S ribosomal protein S20 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219682082|ref|YP_002468466.1| 30S ribosomal protein S20 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|257471207|ref|ZP_05635206.1| 30S ribosomal protein S20 [Buchnera aphidicola str. LSR1
          (Acyrthosiphon pisum)]
 gi|11387074|sp|P57251|RS20_BUCAI RecName: Full=30S ribosomal protein S20
 gi|254813052|sp|B8D8V2|RS20_BUCA5 RecName: Full=30S ribosomal protein S20
 gi|254813053|sp|B8D756|RS20_BUCAT RecName: Full=30S ribosomal protein S20
 gi|25294872|pir||E84947 30S ribosomal protein S20 [imported] - Buchnera sp. (strain APS)
 gi|10038834|dbj|BAB12869.1| 30S ribosomal protein S20 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219621815|gb|ACL29971.1| 30S ribosomal protein S20 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|219624369|gb|ACL30524.1| 30S ribosomal protein S20 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311085893|gb|ADP65975.1| 30S ribosomal protein S20 [Buchnera aphidicola str. LL01
          (Acyrthosiphon pisum)]
 gi|311086466|gb|ADP66547.1| 30S ribosomal protein S20 [Buchnera aphidicola str. TLW03
          (Acyrthosiphon pisum)]
 gi|311087047|gb|ADP67127.1| 30S ribosomal protein S20 [Buchnera aphidicola str. JF99
          (Acyrthosiphon pisum)]
 gi|311087607|gb|ADP67686.1| 30S ribosomal protein S20 [Buchnera aphidicola str. JF98
          (Acyrthosiphon pisum)]
          Length = 89

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  ++KK      +R   N SRRS +R+F++    AI  G    A +A +K + +I  
Sbjct: 1  MANIKASKKDALTSEKRRKKNSSRRSMIRTFVKKVRVAIMSGNKTTAEDAFKKMQPIIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  S LS ++K I
Sbjct: 61 HVNKGLIHKNKAARYKSNLSLQIKKI 86


>gi|260886844|ref|ZP_05898107.1| ribosomal protein S20 [Selenomonas sputigena ATCC 35185]
 gi|260863443|gb|EEX77943.1| ribosomal protein S20 [Selenomonas sputigena ATCC 35185]
          Length = 90

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%)

Query: 11 IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
          ++K  +R   N + +S VR+  RH  +A+  G  +EA    R A   I +A +  +FH N
Sbjct: 14 VKKDEKRRAKNAAEKSRVRTASRHVLDAVEAGNADEAKSFLRAACKTIDQAAANHVFHKN 73

Query: 71 AASRKVSRLSKRLKGI 86
           A+RK SRL++++  +
Sbjct: 74 CAARKKSRLARKVNAM 89


>gi|320160731|ref|YP_004173955.1| 30S ribosomal protein S20 [Anaerolinea thermophila UNI-1]
 gi|319994584|dbj|BAJ63355.1| 30S ribosomal protein S20 [Anaerolinea thermophila UNI-1]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  ++  +R + N+  R   R+ +  A EA+    +EEA +A   A S + +
Sbjct: 1  MANIKSQIKRNKQNEKRRIRNRIVRGKARTAVAKAREALASQSVEEAKQAVLLAISSLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+R+ SRL KRL  +
Sbjct: 61 AASKGVIHKNNAARRKSRLMKRLAAL 86


>gi|295111317|emb|CBL28067.1| ribosomal protein S20 [Synergistetes bacterium SGP1]
          Length = 91

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SAK+ +R   R  L N+   +  ++ ++   E++  G  E A      A+SV+ K
Sbjct: 1  MPNKQSAKRRVRIEERNRLYNRYWTTRCKTAVKKLLESVEAGDGEAAARNFNLAQSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N ASR+   +++ +KG+
Sbjct: 61 AVVKGVMHRNTASRRKKLMARAVKGL 86


>gi|126697016|ref|YP_001091902.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9301]
 gi|166223965|sp|A3PEX6|RS20_PROM0 RecName: Full=30S ribosomal protein S20
 gi|126544059|gb|ABO18301.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. MIT 9301]
          Length = 97

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEE-------ATEACRK 53
          MAN  SAKK I+   R  LINKS +S+VR+  +   E     K E         T +  K
Sbjct: 1  MANNKSAKKRIQIAERNRLINKSYKSTVRTLTKKTLENCEKYKKEPNDENKNLVTTSLNK 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A S+I KA  K + H N  + + S+++  +K  LT+
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANRKSKINNFVKTTLTT 96


>gi|94676720|ref|YP_588983.1| ribosomal protein S20 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
 gi|118573807|sp|Q1LST1|RS20_BAUCH RecName: Full=30S ribosomal protein S20
 gi|94219870|gb|ABF14029.1| ribosomal protein S20 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
          Length = 87

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +  L N SRRS VR+F+R    AI     + A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKHRLHNASRRSMVRTFVRKVYNAILTQDKKAAQQAFSAMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
            SKG+ H N A+R  S L
Sbjct: 61 QASKGLIHKNKAARYKSHL 79


>gi|325661701|ref|ZP_08150324.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471954|gb|EGC75169.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 92

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NK+ +S V+++++    A+       A EA + A   I K
Sbjct: 6  LANIKSAKKRILVNETKAARNKAIKSKVKTYVKKVETAVAHSDKAAAEEALKAAIVEINK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N  +RKVSRL+K + GI
Sbjct: 66 AGSKGVYHKNTCARKVSRLTKAVNGI 91


>gi|197283928|ref|YP_002149800.1| 30S ribosomal protein S20 [Proteus mirabilis HI4320]
 gi|226695403|sp|B4F2T3|RS20_PROMH RecName: Full=30S ribosomal protein S20
 gi|194681415|emb|CAR40253.1| 30S ribosomal protein S20 [Proteus mirabilis HI4320]
          Length = 86

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    A+  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASRRSMMRTYIKKVYAAVASGDKEAAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  + L  ++K +
Sbjct: 61 QATKGLIHKNKAARHKANLQAQIKAM 86


>gi|260771786|ref|ZP_05880704.1| SSU ribosomal protein S20p [Vibrio metschnikovii CIP 69.14]
 gi|260613078|gb|EEX38279.1| SSU ribosomal protein S20p [Vibrio metschnikovii CIP 69.14]
          Length = 86

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANNKSAKKRAIQSEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR S  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFSAAIKAL 86


>gi|167461403|ref|ZP_02326492.1| 30S ribosomal protein S20 [Paenibacillus larvae subsp. larvae
          BRL-230010]
          Length = 75

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L N S++S +R+ ++     +    ++ A EA   A   + KA SKG+ H N A+RK
Sbjct: 1  KRRLRNASQKSDLRTAIKAFETVVASNNVDSAKEAFVVASKKLDKAASKGLIHKNVANRK 60

Query: 76 VSRLSKRLKGILTSA 90
           SRL+K+L  ++  A
Sbjct: 61 KSRLAKKLNELVAQA 75


>gi|332992320|gb|AEF02375.1| 30S ribosomal subunit protein S20 [Alteromonas sp. SN2]
          Length = 87

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS  R+ ++    AI  G  E A  A   A  ++ +
Sbjct: 1  MANIKSAKKRAIQAEKRRQHNASRRSMTRTSLKKVVAAIASGDKEGAQTAFAAATPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLAAQIKAL 86


>gi|326773581|ref|ZP_08232864.1| ribosomal protein S20 [Actinomyces viscosus C505]
 gi|326636811|gb|EGE37714.1| ribosomal protein S20 [Actinomyces viscosus C505]
          Length = 96

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  S  K I+   +  L NKS +S +++++R   EA+  G  + A E  + A   + K
Sbjct: 11 VANIKSQIKRIKTNEKARLRNKSVKSELKTYVRRVREAVEAGDKDAALEHLKAASRKLDK 70

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S+L+KR+  +
Sbjct: 71 AVSKGVIHKNQAANRKSKLAKRVASL 96


>gi|325478647|gb|EGC81759.1| ribosomal protein S20 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK I    R T  NK+R+S +++ ++   EAI     ++A    +KA+  +++
Sbjct: 1  MANIKSSKKRIDVAKRNTERNKARKSEIKTIIKRFEEAIEEKDADKAAAYFKKADKRLKQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A++K + H N  +R  S+L+K L
Sbjct: 61 AEAKNVMHKNKVARTTSKLAKAL 83


>gi|285017714|ref|YP_003375425.1| 30s ribosomal protein s20 [Xanthomonas albilineans GPE PC73]
 gi|283472932|emb|CBA15437.1| probable 30s ribosomal protein s20 [Xanthomonas albilineans]
          Length = 90

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++   R   N ++RS +R+ ++   +A+       A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAKQTVVRNARNTAQRSMLRTAVKKVIKALDANDATGAEAAFAIAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            S+G+ H N A+R  SRLS R+K I T+A
Sbjct: 61 FSSRGLIHKNKAARHKSRLSARIKAIKTAA 90


>gi|257092769|ref|YP_003166410.1| 30S ribosomal protein S20 [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257045293|gb|ACV34481.1| ribosomal protein S20 [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS++R+ ++   +AI  G    A    R++ S I +
Sbjct: 1  MANSAQARKRARQAVKQRAHNASLRSTLRTAVKRVQKAIVAGDKAAAQSIFRESVSTIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N ASR  SRL+ ++KG+
Sbjct: 61 IADKKIIHKNKASRHKSRLAAQIKGL 86


>gi|239626107|ref|ZP_04669138.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47_FAA]
 gi|239520337|gb|EEQ60203.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47FAA]
          Length = 87

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +   NK+ RS V++ ++  + AI  G    A  A   A S I K
Sbjct: 1  MANIKSAKKRILVNETKAARNKAIRSKVKTAIKKVDAAIAAGDKAAAQAALLAATSEIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H N ASRKVSRLSK +  I
Sbjct: 61 ACTKGVYHSNTASRKVSRLSKAVNSI 86


>gi|15613902|ref|NP_242205.1| 30S ribosomal protein S20 [Bacillus halodurans C-125]
 gi|17865599|sp|Q9KD79|RS20_BACHD RecName: Full=30S ribosomal protein S20
 gi|10173955|dbj|BAB05058.1| 30S ribosomal protein S20 [Bacillus halodurans C-125]
          Length = 91

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%)

Query: 2  ANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKA 61
          AN  SA K ++   +R + N S +S++R+ ++     +     E A  A  +A   + KA
Sbjct: 5  ANIKSAIKRVKTNEKRRIQNASVKSALRTAIKQFEAKVENNDAEAAKAAFVEATKKLDKA 64

Query: 62 KSKGIFHGNAASRKVSRLSKRLKGI 86
           +KG+ H NAASR+ SRL+K+L G+
Sbjct: 65 ANKGLIHKNAASRQKSRLAKKLNGL 89


>gi|71279059|ref|YP_267922.1| 30S ribosomal protein S20 [Colwellia psychrerythraea 34H]
 gi|115305678|sp|Q486U3|RS20_COLP3 RecName: Full=30S ribosomal protein S20
 gi|71144799|gb|AAZ25272.1| ribosomal protein S20 [Colwellia psychrerythraea 34H]
          Length = 86

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK   +  +R   N SRRS +R+ ++    AI  G  E AT+    A   + +
Sbjct: 1  MANSKQAKKRAGQSEKRRQHNASRRSMMRTLVKKVLAAIEAGDKEVATKELAAATPTLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  SRL+  +K +
Sbjct: 61 YASKGLIHKNKAARSKSRLNAAIKAL 86


>gi|206602936|gb|EDZ39416.1| Ribosomal protein S20 [Leptospirillum sp. Group II '5-way CG']
          Length = 87

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  +  K I+K  +R   N+   S +R+  +     ++ GK EEA  A  +   VI  
Sbjct: 1  MASHKATLKDIKKNEKRRARNRQAVSMIRTMAKKVETLVSQGKKEEAVVALGEVVPVIDH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++ I H N+ASRK+SRL+ ++ G+
Sbjct: 61 AVNRRILHRNSASRKISRLTLKVNGL 86


>gi|313895000|ref|ZP_07828557.1| ribosomal protein S20 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312975895|gb|EFR41353.1| ribosomal protein S20 [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 11 IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
          ++  A+R   N + ++ VR  +R  N+A+  G  +EA      A   I +A +  ++H N
Sbjct: 11 VKSDAKRRARNVAEKTRVRRAIRSVNDAVAAGNADEAKNLLVAAYKSIDQAAANNVYHKN 70

Query: 71 AASRKVSRLSKRLKGI 86
          AA+RK SRL+K++  +
Sbjct: 71 AAARKKSRLAKKVNAL 86


>gi|209694169|ref|YP_002262097.1| 30S ribosomal protein S20 [Aliivibrio salmonicida LFI1238]
 gi|226735290|sp|B6EMY3|RS20_ALISL RecName: Full=30S ribosomal protein S20
 gi|208008120|emb|CAQ78262.1| 30S ribosomal protein S20 [Aliivibrio salmonicida LFI1238]
          Length = 86

 Score = 43.5 bits (101), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  RR   N SRRS +R++M+    AI  G  E AT A   A  ++ +
Sbjct: 1  MANSKSAKKRATQAERRRQHNASRRSMMRTYMKKTIAAIEAGDKEAATAALAIATPLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +R +  +K +
Sbjct: 61 MATKGLIHKNKAARHKARFTAAIKAL 86


>gi|238923980|ref|YP_002937496.1| hypothetical protein EUBREC_1618 [Eubacterium rectale ATCC 33656]
 gi|238875655|gb|ACR75362.1| Hypothetical protein EUBREC_1618 [Eubacterium rectale ATCC 33656]
          Length = 92

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NK+ +S V++ ++    A+       A  A + A SVI  
Sbjct: 6  LANIKSAKKRILVTETKAARNKAIKSGVKTAIKKVEAAVAANDKAAAEAALKDATSVIAS 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKGIFH N A+RKVSRL+K + G+
Sbjct: 66 AGSKGIFHKNNAARKVSRLTKLVNGL 91


>gi|182682046|ref|YP_001830206.1| 30S ribosomal protein S20 [Xylella fastidiosa M23]
 gi|182632156|gb|ACB92932.1| ribosomal protein S20 [Xylella fastidiosa M23]
          Length = 109

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 52/89 (58%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK +++   R   N ++RS +R+ ++   +A++   I  A  A   A+ ++ +
Sbjct: 21  VANIKSAKKRVKQTVVRNERNTAQRSMLRTAVKKVIKALSIKDIAGAETAFAVAQPILDR 80

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
             S+G+ H N A+R  SRL+ R+K + T+
Sbjct: 81  FSSRGLIHKNKAARHKSRLTARIKALKTA 109


>gi|118602732|ref|YP_903947.1| SSU ribosomal protein S20P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|118567671|gb|ABL02476.1| SSU ribosomal protein S20P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   ++K  R+  +R   N   R+ VR+F++    A+  G  E+A       + +I +
Sbjct: 12 MANSAGSRKRARQAVKRNKHNSQIRAKVRTFIKKVAYALEAGNKEQAQSGFSIMQKIIDQ 71

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H + A+RK SRL+ ++K +
Sbjct: 72 AVNKGLMHKSQAARKKSRLNAQIKAL 97


>gi|22127576|ref|NP_670999.1| 30S ribosomal protein S20 [Yersinia pestis KIM 10]
 gi|45443440|ref|NP_994979.1| 30S ribosomal protein S20 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51594966|ref|YP_069157.1| 30S ribosomal protein S20 [Yersinia pseudotuberculosis IP 32953]
 gi|108810056|ref|YP_653972.1| 30S ribosomal protein S20 [Yersinia pestis Antiqua]
 gi|108810510|ref|YP_646277.1| 30S ribosomal protein S20 [Yersinia pestis Nepal516]
 gi|145600414|ref|YP_001164490.1| 30S ribosomal protein S20 [Yersinia pestis Pestoides F]
 gi|150260492|ref|ZP_01917220.1| 30S ribosomal protein S20 [Yersinia pestis CA88-4125]
 gi|153947944|ref|YP_001402417.1| 30S ribosomal protein S20 [Yersinia pseudotuberculosis IP 31758]
 gi|162421033|ref|YP_001605367.1| 30S ribosomal protein S20 [Yersinia pestis Angola]
 gi|165927261|ref|ZP_02223093.1| ribosomal protein S20 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|166009053|ref|ZP_02229951.1| ribosomal protein S20 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166212224|ref|ZP_02238259.1| ribosomal protein S20 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167401666|ref|ZP_02307160.1| ribosomal protein S20 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167419208|ref|ZP_02310961.1| ribosomal protein S20 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167426089|ref|ZP_02317842.1| ribosomal protein S20 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|170025805|ref|YP_001722310.1| 30S ribosomal protein S20 [Yersinia pseudotuberculosis YPIII]
 gi|186893968|ref|YP_001871080.1| 30S ribosomal protein S20 [Yersinia pseudotuberculosis PB1/+]
 gi|218927669|ref|YP_002345544.1| 30S ribosomal protein S20 [Yersinia pestis CO92]
 gi|229836945|ref|ZP_04457110.1| 30S ribosomal subunit protein S20 [Yersinia pestis Pestoides A]
 gi|229840360|ref|ZP_04460519.1| 30S ribosomal subunit protein S20 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229842440|ref|ZP_04462595.1| 30S ribosomal subunit protein S20 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229900699|ref|ZP_04515823.1| 30S ribosomal subunit protein S20 [Yersinia pestis Nepal516]
 gi|270487933|ref|ZP_06205007.1| ribosomal protein S20 [Yersinia pestis KIM D27]
 gi|20978697|sp|Q8ZIM3|RS20_YERPE RecName: Full=30S ribosomal protein S20
 gi|59798665|sp|Q66ES6|RS20_YERPS RecName: Full=30S ribosomal protein S20
 gi|118573850|sp|Q1C0J5|RS20_YERPA RecName: Full=30S ribosomal protein S20
 gi|118573851|sp|Q1CMV3|RS20_YERPN RecName: Full=30S ribosomal protein S20
 gi|166224002|sp|A4TQF5|RS20_YERPP RecName: Full=30S ribosomal protein S20
 gi|167011218|sp|A7FMD9|RS20_YERP3 RecName: Full=30S ribosomal protein S20
 gi|226695444|sp|B2K3M4|RS20_YERPB RecName: Full=30S ribosomal protein S20
 gi|226695445|sp|A9R010|RS20_YERPG RecName: Full=30S ribosomal protein S20
 gi|226695446|sp|B1JL00|RS20_YERPY RecName: Full=30S ribosomal protein S20
 gi|21960682|gb|AAM87250.1|AE013973_9 30S ribosomal subunit protein S20 [Yersinia pestis KIM 10]
 gi|45438309|gb|AAS63856.1| 30S ribosomal protein S20 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51588248|emb|CAH19855.1| 30S ribosomal subunit protein S20 [Yersinia pseudotuberculosis IP
          32953]
 gi|108774158|gb|ABG16677.1| SSU ribosomal protein S20P [Yersinia pestis Nepal516]
 gi|108781969|gb|ABG16027.1| SSU ribosomal protein S20P [Yersinia pestis Antiqua]
 gi|115346280|emb|CAL19151.1| 30S ribosomal protein S20 [Yersinia pestis CO92]
 gi|145212110|gb|ABP41517.1| SSU ribosomal protein S20P [Yersinia pestis Pestoides F]
 gi|149289900|gb|EDM39977.1| 30S ribosomal protein S20 [Yersinia pestis CA88-4125]
 gi|152959439|gb|ABS46900.1| ribosomal protein S20 [Yersinia pseudotuberculosis IP 31758]
 gi|162353848|gb|ABX87796.1| ribosomal protein S20 [Yersinia pestis Angola]
 gi|165920723|gb|EDR37971.1| ribosomal protein S20 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165992392|gb|EDR44693.1| ribosomal protein S20 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166206970|gb|EDR51450.1| ribosomal protein S20 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166963202|gb|EDR59223.1| ribosomal protein S20 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167049048|gb|EDR60456.1| ribosomal protein S20 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167055012|gb|EDR64812.1| ribosomal protein S20 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|169752339|gb|ACA69857.1| ribosomal protein S20 [Yersinia pseudotuberculosis YPIII]
 gi|186696994|gb|ACC87623.1| ribosomal protein S20 [Yersinia pseudotuberculosis PB1/+]
 gi|229682038|gb|EEO78130.1| 30S ribosomal subunit protein S20 [Yersinia pestis Nepal516]
 gi|229690750|gb|EEO82804.1| 30S ribosomal subunit protein S20 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229696726|gb|EEO86773.1| 30S ribosomal subunit protein S20 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229705888|gb|EEO91897.1| 30S ribosomal subunit protein S20 [Yersinia pestis Pestoides A]
 gi|270336437|gb|EFA47214.1| ribosomal protein S20 [Yersinia pestis KIM D27]
 gi|320016963|gb|ADW00535.1| 30S ribosomal subunit protein S20 [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 87

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI  G  + A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMVRTFIKKVYAAIAAGDKDAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L  ++  +
Sbjct: 61 QSCKGLIHKNKAARHKSNLVAQINAM 86


>gi|296170532|ref|ZP_06852116.1| trigger factor [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894764|gb|EFG74489.1| trigger factor [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 86

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  R   R  L NKS +SS+R+ +R   EA   G  E+ATE        + K
Sbjct: 1  MANIKSQQKRNRTNERARLRNKSVKSSLRTAVRAFREATHAGDKEKATELLAATNRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ K S L++ L  +
Sbjct: 61 AASKGVIHKNQAANKKSALARALNKL 86


>gi|153814927|ref|ZP_01967595.1| hypothetical protein RUMTOR_01142 [Ruminococcus torques ATCC
          27756]
 gi|317500439|ref|ZP_07958663.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|145847958|gb|EDK24876.1| hypothetical protein RUMTOR_01142 [Ruminococcus torques ATCC
          27756]
 gi|316898194|gb|EFV20241.1| 30S ribosomal protein S20 [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 92

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NK+ +S V++ ++    A+     E A  A R A   I K
Sbjct: 6  LANIKSAKKRILVNETKAARNKAIKSKVKTAVKKVEAAVAAKDAETAKTALRAAIVEISK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H    SRK+SRLSK +  I
Sbjct: 66 AGTKGVYHKKTVSRKISRLSKAVSSI 91


>gi|71276196|ref|ZP_00652475.1| Ribosomal protein S20p [Xylella fastidiosa Dixon]
 gi|71898767|ref|ZP_00680936.1| Ribosomal protein S20p [Xylella fastidiosa Ann-1]
 gi|71900455|ref|ZP_00682586.1| Ribosomal protein S20p [Xylella fastidiosa Ann-1]
 gi|170730688|ref|YP_001776121.1| 30S ribosomal protein S20 [Xylella fastidiosa M12]
 gi|9107609|gb|AAF85220.1|AE004051_4 30S ribosomal protein S20 [Xylella fastidiosa 9a5c]
 gi|71162957|gb|EAO12680.1| Ribosomal protein S20p [Xylella fastidiosa Dixon]
 gi|71729761|gb|EAO31861.1| Ribosomal protein S20p [Xylella fastidiosa Ann-1]
 gi|71731532|gb|EAO33594.1| Ribosomal protein S20p [Xylella fastidiosa Ann-1]
 gi|167965481|gb|ACA12491.1| 30S ribosomal protein S20 [Xylella fastidiosa M12]
          Length = 109

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 52/89 (58%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           +AN  SAKK +++   R   N ++RS +R+ ++   +A++   I  A  A   A+ ++ +
Sbjct: 21  VANIKSAKKRVKQTVVRNERNTAQRSMLRTAVKKVIKALSIKDIAGAETAFAVAQPILDR 80

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
             S+G+ H N A+R  SRL+ R+K + T+
Sbjct: 81  FSSRGLIHKNKAARHKSRLTARIKALKTA 109


>gi|332703857|ref|ZP_08423945.1| 30S ribosomal protein S20 [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332554006|gb|EGJ51050.1| 30S ribosomal protein S20 [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +    NK+ ++ VR+ ++    A++ G  ++A+ A  +A S++  
Sbjct: 1  MANHKSAEKRHRQSLKANARNKAMKTRVRNAVKAVRTAVSEGNADQASVALTQATSILDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A  K + H   A RKVSRLS+
Sbjct: 61 AAQKKVIHWRNAGRKVSRLSQ 81


>gi|256396178|ref|YP_003117742.1| 30S ribosomal protein S20 [Catenulispora acidiphila DSM 44928]
 gi|256362404|gb|ACU75901.1| ribosomal protein S20 [Catenulispora acidiphila DSM 44928]
          Length = 88

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +SS+++ +R   EA+  G   +A E  + A   + KA SKG+ H N A+ K S L+
Sbjct: 21 NKAVKSSLKTAIRKTREAVESGDTAKAQELAQAASRELDKAASKGVIHANQAANKKSALA 80

Query: 81 KRLKGI 86
          K + G+
Sbjct: 81 KSVNGL 86


>gi|260903875|ref|ZP_05912197.1| 30S ribosomal protein S20 [Brevibacterium linens BL2]
          Length = 86

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ RS VRS +R   E I  GK +EA +A   A   + KA SKG+ H N A+ + SR++
Sbjct: 21 NKAVRSEVRSHVRVVRENIAAGKKDEAQQAYAVAARKLDKAVSKGVLHKNNAANRKSRMA 80

Query: 81 KRLKGI 86
           ++  +
Sbjct: 81 TQINAL 86


>gi|148265159|ref|YP_001231865.1| 30S ribosomal protein S20 [Geobacter uraniireducens Rf4]
 gi|189044865|sp|A5G674|RS20_GEOUR RecName: Full=30S ribosomal protein S20
 gi|146398659|gb|ABQ27292.1| SSU ribosomal protein S20P [Geobacter uraniireducens Rf4]
          Length = 87

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 47/81 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I++  +RT  N+  RS++R+F++   EA        A EA   A  VI  
Sbjct: 1  MANHKSALKRIKQTEKRTERNRHVRSTLRTFIKRVREAAAAKDAALAKEALAAAIPVIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H + ASR +SRL+K
Sbjct: 61 AASKGVIHSSNASRNISRLTK 81


>gi|123966900|ref|YP_001011981.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9515]
 gi|166223968|sp|A2BYL3|RS20_PROM5 RecName: Full=30S ribosomal protein S20
 gi|123201266|gb|ABM72874.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. MIT 9515]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SAKK I+   R  L+NKS +S+V++  +         K++  ++       +  +
Sbjct: 1  MANNKSAKKRIKVAERNRLVNKSYKSTVKTLTKKTLANCEKYKLDPNSDNKNLVMFSLSE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A S+I KA  K + H N  + K S+++K +K  LTS
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANKKSKINKLVKNFLTS 96


>gi|158522447|ref|YP_001530317.1| ribosomal protein S20 [Desulfococcus oleovorans Hxd3]
 gi|226736483|sp|A8ZVQ3|RS20_DESOH RecName: Full=30S ribosomal protein S20
 gi|158511273|gb|ABW68240.1| ribosomal protein S20 [Desulfococcus oleovorans Hxd3]
          Length = 88

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 1  MAN-KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59
          MAN K S K+  + I R T  NKSR++++++  +  +  +  G  E+A      A+ +  
Sbjct: 1  MANHKSSLKRAKQDIVRNTR-NKSRKTALKTITKKVDALVADGAAEDAKTTLLAAQKLFD 59

Query: 60 KAKSKGIFHGNAASRKVSRLSKRL 83
          +  +KG  H   ASRK+SRL++R+
Sbjct: 60 QTAAKGTIHKKTASRKISRLTRRV 83


>gi|297623108|ref|YP_003704542.1| 30S ribosomal protein S20 [Truepera radiovictrix DSM 17093]
 gi|297164288|gb|ADI13999.1| ribosomal protein S20 [Truepera radiovictrix DSM 17093]
          Length = 94

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA   SA K  R+  +    N++ +S++R+F + A EA   G +E A +  R   S+I +
Sbjct: 1  MARNPSAMKYHRQSQKARAKNRAAKSTIRTFGKKAVEAAERGDLEAAAKFQRVTVSLIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A      H NAA+R+ SRL++RL
Sbjct: 61 AAKGSTLHKNAAARRKSRLARRL 83


>gi|116620842|ref|YP_822998.1| 30S ribosomal protein S20 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|122255073|sp|Q027U4|RS20_SOLUE RecName: Full=30S ribosomal protein S20
 gi|116224004|gb|ABJ82713.1| SSU ribosomal protein S20P [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 88

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K +R+  RRT +N+  ++ +R  +R    AIT   ++ A E      SVI +
Sbjct: 1  MANTYSALKRVRQTERRTEVNRKNKTRLRHQIRAMRRAITAKDVKVAGELLPVTFSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          +   GI   N A+R  S+L  R+K +
Sbjct: 61 SAKSGIIKKNTAARYKSKLHLRVKAL 86


>gi|119946880|ref|YP_944560.1| ribosomal protein S20 [Psychromonas ingrahamii 37]
 gi|166223974|sp|A1SZP6|RS20_PSYIN RecName: Full=30S ribosomal protein S20
 gi|119865484|gb|ABM04961.1| SSU ribosomal protein S20P [Psychromonas ingrahamii 37]
          Length = 86

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRR+ +R+F++    AI     E AT    K +SV+  
Sbjct: 1  MANIKSAKKRALQSEKSRKHNASRRTMMRTFIKKVVVAIEAANKEVATAEFVKLQSVLDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ + N A+RK SRLS ++K +
Sbjct: 61 YATKGLINKNTAARKKSRLSAKIKAL 86


>gi|110004110|emb|CAK98449.1| putative 30s ribosomal protein s20 [Spiroplasma citri]
          Length = 83

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K ++  ++  L NKS +SSV++ ++ A  AIT  +   A+E    A +++ K
Sbjct: 1  MANIKSQIKRVKTNSKTNLANKSFKSSVKTAIKKAEIAIT-AQEANASELVNTAITLVDK 59

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A +KGI+H N A+   SRL
Sbjct: 60 AVTKGIYHANKAAHVKSRL 78


>gi|94970573|ref|YP_592621.1| 30S ribosomal protein S20 [Candidatus Koribacter versatilis
          Ellin345]
 gi|118573805|sp|Q1IKQ3|RS20_ACIBL RecName: Full=30S ribosomal protein S20
 gi|94552623|gb|ABF42547.1| SSU ribosomal protein S20P [Candidatus Koribacter versatilis
          Ellin345]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 43/84 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+   RT  N++  S +R+ +R    AI  G   +         S++ K
Sbjct: 1  MANHYSALKRARQTETRTARNRANTSRMRTQLRALRTAIAGGDAAQVKTEFSGTVSLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          A  KG+ H N ASR  +RLS R+K
Sbjct: 61 AVQKGVLHKNTASRYKARLSARVK 84


>gi|152991660|ref|YP_001357381.1| 30S ribosomal protein S20 [Sulfurovum sp. NBC37-1]
 gi|166223994|sp|A6Q6B5|RS20_SULNB RecName: Full=30S ribosomal protein S20
 gi|151423521|dbj|BAF71024.1| 30S ribosomal protein S20 [Sulfurovum sp. NBC37-1]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK I + A+RT  N+  R+ +++  +  +EA+    +  A EA + A   I  
Sbjct: 1  MAHHKSAKKRILQTAKRTERNRYYRTRIKNITKAVHEAVEAADMTAAQEAFKVANKQIHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG      A+RKVSRL K +  I
Sbjct: 61 LVSKGFIKKATAARKVSRLHKMVNKI 86


>gi|119470023|ref|ZP_01612828.1| 30S ribosomal subunit protein S20 [Alteromonadales bacterium
          TW-7]
 gi|119446733|gb|EAW28006.1| 30S ribosomal subunit protein S20 [Alteromonadales bacterium
          TW-7]
          Length = 86

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +    N SRRS +R++ +    AI  G  E A +A   A  ++ +
Sbjct: 1  MANIKSAKKRAITSEKNRQHNASRRSMMRTYFKKVVVAIEAGDKEAAQQAFSVATPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 YATKGLIHKNKAARHKSRLAAKIKAL 86


>gi|300788522|ref|YP_003768813.1| 30S ribosomal protein S20 [Amycolatopsis mediterranei U32]
 gi|299798036|gb|ADJ48411.1| small subunit ribosomal protein S20 [Amycolatopsis mediterranei
          U32]
          Length = 86

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N++ RSSV++ +R   EA   G   +A E  R A   + KA SKG+ H N A+ K S L+
Sbjct: 21 NQAIRSSVKTAIRKVREAAEAGDKAKAVELQRDAAQKLDKAVSKGVIHANQAANKKSALA 80

Query: 81 KRLKGI 86
          KR+  +
Sbjct: 81 KRVNAL 86


>gi|302339672|ref|YP_003804878.1| ribosomal protein S20 [Spirochaeta smaragdinae DSM 11293]
 gi|301636857|gb|ADK82284.1| ribosomal protein S20 [Spirochaeta smaragdinae DSM 11293]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M +  SA+K  R+  +R L N+  +S V +  R  + A+  G  E A +A +    +I K
Sbjct: 1  MPSNKSAEKRHRQNQKRRLRNRIMKSGVHTARRKVDAALKSGDKEAAEQAYKAYVQLIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  K + H N A+RK SRLSK L  +
Sbjct: 61 AARKSVLHKNNAARKKSRLSKALNAL 86


>gi|299144176|ref|ZP_07037256.1| ribosomal protein S20 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
 gi|298518661|gb|EFI42400.1| ribosomal protein S20 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
          Length = 87

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I  I R    NKS ++ V+S ++    A+  G I+EA E  +  +  ++K
Sbjct: 1  MANIKSAIKRIDVIKRNNARNKSIKTEVKSAVKKFESALEAGNIDEARELLKLVDKKLKK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A    I H NAA+RK+SRL+
Sbjct: 61 AAHNNIVHKNAAARKISRLT 80


>gi|225570588|ref|ZP_03779613.1| hypothetical protein CLOHYLEM_06690 [Clostridium hylemonae DSM
          15053]
 gi|225160601|gb|EEG73220.1| hypothetical protein CLOHYLEM_06690 [Clostridium hylemonae DSM
          15053]
          Length = 95

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NKS +S V++ ++    A+       A +A + A   I K
Sbjct: 9  LANIKSAKKRILVNETKAARNKSIKSKVKTCVKKVETAVANKDAAVAADALKTAIREINK 68

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG++H N  +RK+SRL+K +  I
Sbjct: 69 AGSKGVYHKNTCARKISRLTKAVNEI 94


>gi|50122799|ref|YP_051966.1| 30S ribosomal protein S20 [Pectobacterium atrosepticum SCRI1043]
 gi|59798690|sp|Q6D0C1|RS20_ERWCT RecName: Full=30S ribosomal protein S20
 gi|49613325|emb|CAG76776.1| 30S ribosomal protein S20 [Pectobacterium atrosepticum SCRI1043]
          Length = 87

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S RS +R+F++    AI  G  E A +A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASSRSMMRTFIKKVYAAIATGDKEVAQKAFNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+R  S L  R+  +
Sbjct: 61 QASKGLIHKNKAARHKSNLVARINAM 86


>gi|282895795|ref|ZP_06303882.1| Ribosomal protein S20p [Raphidiopsis brookii D9]
 gi|282900413|ref|ZP_06308363.1| Ribosomal protein S20p [Cylindrospermopsis raciborskii CS-505]
 gi|281194726|gb|EFA69673.1| Ribosomal protein S20p [Cylindrospermopsis raciborskii CS-505]
 gi|281199295|gb|EFA74161.1| Ribosomal protein S20p [Raphidiopsis brookii D9]
          Length = 97

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (53%), Gaps = 7/93 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEA----TEACRK 53
          MAN  SA K  +   R  L NK+ +S+V++ M+    A EA       E+     E   +
Sbjct: 1  MANTKSALKRAQIAERNQLHNKAYKSAVKTLMKKYFAAVEAYASNPTSESKQLVDERMSQ 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          A S I KA  +G+ H N+ +RK SRL+++LK +
Sbjct: 61 AYSKIDKAVKRGVLHPNSGARKKSRLARKLKPL 93


>gi|321444432|gb|EFX60403.1| hypothetical protein DAPPUDRAFT_343955 [Daphnia pulex]
          Length = 93

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K +R+  +    N S RS  R+ +++  +A+  G   +A E   K ++V+     KG
Sbjct: 14 SGRKRVRQDIKLNAANTSLRSKYRTAVKNVEKAVLAGDKTKAAELFAKMQAVVDTVADKG 73

Query: 66 IFHGNAASRKVSRLS 80
          IFH N A+R  SRLS
Sbjct: 74 IFHKNKAARDKSRLS 88


>gi|298245600|ref|ZP_06969406.1| ribosomal protein S20 [Ktedonobacter racemifer DSM 44963]
 gi|297553081|gb|EFH86946.1| ribosomal protein S20 [Ktedonobacter racemifer DSM 44963]
          Length = 93

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIE-EATEAC-RKAESVI 58
          M N  SA+K +R+  +R   N+S +S V+S +  A  AI    +  +A+EA  R A S +
Sbjct: 1  MPNNASAEKRMRQEQKRRAHNRSVKSKVKSTITKARTAIATDNVAFDASEAAVRAAISEL 60

Query: 59 QKAKSKGIFHGNAASRKVSRLSKRL 83
           +A  KG+ H N ASR+ SRL K+L
Sbjct: 61 DRAAKKGVIHKNNASRRKSRLMKQL 85


>gi|332529036|ref|ZP_08405001.1| 30S ribosomal protein S20 [Hylemonella gracilis ATCC 19624]
 gi|332041480|gb|EGI77841.1| 30S ribosomal protein S20 [Hylemonella gracilis ATCC 19624]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K  R+  +    N S RS  R+ +++  +A+  G   +ATE   K ++V+     K 
Sbjct: 15 SGRKRARQDVKLNAANTSLRSKYRTAVKNVEKAVLTGDKAKATELFAKMQAVVDSVADKQ 74

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
          IFH N A+R  SRLS ++K +  +A
Sbjct: 75 IFHKNKAARDKSRLSAKVKALGAAA 99


>gi|238897595|ref|YP_002923274.1| 30S ribosomal subunit protein S20 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|259494866|sp|C4K3I3|RS20_HAMD5 RecName: Full=30S ribosomal protein S20
 gi|229465352|gb|ACQ67126.1| 30S ribosomal subunit protein S20 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 109

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS VR+F++    AI+ G  + A  A  + + +I +
Sbjct: 1  MANIKSAKKRAIQSEKRRKHNASRRSMVRTFIKKVYAAISSGDKKAAETAFAQMQPIIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L+ ++  +
Sbjct: 61 HACKGLIHKNKAARHKSNLTAQINAM 86


>gi|37197609|dbj|BAC93448.1| ribosomal protein S20 [Vibrio vulnificus YJ016]
          Length = 91

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 6  LANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR + ++K +
Sbjct: 66 MATKGLIHKNKAARHKSRFAAQIKAL 91


>gi|115377913|ref|ZP_01465098.1| ribosomal protein S20 [Stigmatella aurantiaca DW4/3-1]
 gi|115365073|gb|EAU64123.1| ribosomal protein S20 [Stigmatella aurantiaca DW4/3-1]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +R   N + R++V++ ++ A E +      ++ +A + A   + K
Sbjct: 1  MANTKSAEKRNRQTQKRRARNAAVRTTVKNAVKKARETLATKDTAKSADAVKDATRTLAK 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A SKGI H   A+R+++RL
Sbjct: 61 AASKGILHPRNAARRIARL 79


>gi|163840675|ref|YP_001625080.1| 30S ribosomal protein S20 [Renibacterium salmoninarum ATCC 33209]
 gi|189044878|sp|A9WQT7|RS20_RENSM RecName: Full=30S ribosomal protein S20
 gi|162954151|gb|ABY23666.1| SSU ribosomal protein S20P [Renibacterium salmoninarum ATCC
          33209]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  L N + +S +++ +R  N+A+  G  E A EA   A   + K
Sbjct: 1  MANIKSQKKRILTNEKARLRNNAVKSELKTAVRAVNQAVEAGNKETAGEALVHASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S +SK++  +
Sbjct: 61 AVSKGVIHSNQAANRKSAISKKVSAL 86


>gi|42522980|ref|NP_968360.1| 30S ribosomal protein S20 [Bdellovibrio bacteriovorus HD100]
 gi|59798737|sp|Q6MMZ9|RS20_BDEBA RecName: Full=30S ribosomal protein S20
 gi|39574176|emb|CAE79353.1| 30S ribosomal protein S20 [Bdellovibrio bacteriovorus HD100]
          Length = 87

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  R+T +N +R+S+V++  +   +AI    ++   E  +   S + K
Sbjct: 1  MANHKSAAKRARQSIRKTAVNNARKSTVKTAEKKLVKAIEAKDLKALPELLKNFSSQVMK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKR 82
          A   G+     ASRK+SRLS R
Sbjct: 61 AAKTGVIKKETASRKISRLSTR 82


>gi|224128071|ref|XP_002329074.1| predicted protein [Populus trichocarpa]
 gi|222869743|gb|EEF06874.1| predicted protein [Populus trichocarpa]
          Length = 182

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 9/91 (9%)

Query: 5   DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAIT---------FGKIEEATEACRKAE 55
           DSA+K  R+  +R + NK+R+S V++ M+   EA+          F ++    +   +A 
Sbjct: 75  DSAEKRTRQAEKRRVYNKARKSEVKTRMKKVLEALDDLKKKPEAQFEEVLPIEKLIAEAY 134

Query: 56  SVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           SVI KA   G  H N  +R+ SRL++R K +
Sbjct: 135 SVIDKAIKVGTLHRNTGARRKSRLARRKKAV 165


>gi|315126080|ref|YP_004068083.1| 30S ribosomal subunit protein S20 [Pseudoalteromonas sp. SM9913]
 gi|315014594|gb|ADT67932.1| 30S ribosomal subunit protein S20 [Pseudoalteromonas sp. SM9913]
          Length = 86

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +    N SRRS +R++ +    AI  G  E A +A   A  ++ +
Sbjct: 1  MANIKSAKKRAITSEKNRQHNASRRSMMRTYFKKVIVAIEAGDKEAAQQAFSVATPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 YATKGLIHKNKAARHKSRLAAKIKAL 86


>gi|269926063|ref|YP_003322686.1| ribosomal protein S20 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789723|gb|ACZ41864.1| ribosomal protein S20 [Thermobaculum terrenum ATCC BAA-798]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +ANK SA+K  R   +R L NKS ++ VR+ +      +  G +  A +    A S + +
Sbjct: 9  LANKRSAEKAHRVSEKRRLRNKSIKNRVRTMISKVRRPLLAGDVATAEQNLAAAISALDR 68

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H N A+R+ SRL K
Sbjct: 69 AVSKGVLHRNNAARRKSRLMK 89


>gi|292670343|ref|ZP_06603769.1| 30S ribosomal protein S20 [Selenomonas noxia ATCC 43541]
 gi|292648074|gb|EFF66046.1| 30S ribosomal protein S20 [Selenomonas noxia ATCC 43541]
          Length = 103

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 11  IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
           ++  A+R   N + ++ VR  +R  N+A+  G  +EA      A   I +A +  ++H N
Sbjct: 26  VKSDAKRRARNVAEKTRVRRAIRSVNDAVAAGNADEAKTLLVAAYKSIDQAAANNVYHKN 85

Query: 71  AASRKVSRLSKRLKGI 86
           AA+RK SRL+K++  +
Sbjct: 86  AAARKKSRLAKKVNAL 101


>gi|117927984|ref|YP_872535.1| SSU ribosomal protein S20P [Acidothermus cellulolyticus 11B]
 gi|117648447|gb|ABK52549.1| SSU ribosomal protein S20P [Acidothermus cellulolyticus 11B]
          Length = 151

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K IR+  RR L NK+ +S++++ +R   EA   G+ +EA    R+A   + K
Sbjct: 1  MANIKSQIKRIRQNERRRLRNKAVKSALKTAIRRFREAADAGRTDEAIALMRRACRSLDK 60

Query: 61 AKSKGIFHGN-AASRK 75
          A SKG+ H N AA+RK
Sbjct: 61 AVSKGVIHRNQAANRK 76


>gi|288574738|ref|ZP_06393095.1| ribosomal protein S20 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570479|gb|EFC92036.1| ribosomal protein S20 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 91

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SA++ +R   R  L N+  +S  ++ ++   E+++ G +E A +    A+SV+ K
Sbjct: 1  MPNKQSARRRVRTSERNRLYNRYWKSRCKTAVKRVLESVSAGDVELAAKRLDMAQSVLDK 60

Query: 61 AKSKGIFHGN 70
          A  KG+ H N
Sbjct: 61 AVVKGVVHKN 70


>gi|91794077|ref|YP_563728.1| 30S ribosomal protein S20 [Shewanella denitrificans OS217]
 gi|122968563|sp|Q12KM1|RS20_SHEDO RecName: Full=30S ribosomal protein S20
 gi|91716079|gb|ABE56005.1| SSU ribosomal protein S20P [Shewanella denitrificans OS217]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    AI  G  + ATEA   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIKSGDHKAATEAFAAAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R+ +RL+ ++K +
Sbjct: 61 MATKGLIHKNKAARQKARLNTKIKAL 86


>gi|30022401|ref|NP_834032.1| 30S ribosomal protein S20 [Bacillus cereus ATCC 14579]
 gi|47569318|ref|ZP_00240002.1| ribosomal protein S20 [Bacillus cereus G9241]
 gi|65321695|ref|ZP_00394654.1| COG0268: Ribosomal protein S20 [Bacillus anthracis str. A2012]
 gi|161486559|ref|NP_846770.2| 30S ribosomal protein S20 [Bacillus anthracis str. Ames]
 gi|161511019|ref|NP_980696.2| 30S ribosomal protein S20 [Bacillus cereus ATCC 10987]
 gi|161611178|ref|YP_030469.2| 30S ribosomal protein S20 [Bacillus anthracis str. Sterne]
 gi|161611192|ref|YP_021193.3| 30S ribosomal protein S20 [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|161761255|ref|YP_038377.2| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|161763550|ref|YP_085648.2| 30S ribosomal protein S20 [Bacillus cereus E33L]
 gi|165872099|ref|ZP_02216739.1| ribosomal protein S20 [Bacillus anthracis str. A0488]
 gi|167634613|ref|ZP_02392933.1| ribosomal protein S20 [Bacillus anthracis str. A0442]
 gi|167638564|ref|ZP_02396840.1| ribosomal protein S20 [Bacillus anthracis str. A0193]
 gi|170687505|ref|ZP_02878722.1| ribosomal protein S20 [Bacillus anthracis str. A0465]
 gi|170707408|ref|ZP_02897862.1| ribosomal protein S20 [Bacillus anthracis str. A0389]
 gi|177653241|ref|ZP_02935493.1| ribosomal protein S20 [Bacillus anthracis str. A0174]
 gi|190566986|ref|ZP_03019902.1| ribosomal protein S20 [Bacillus anthracis Tsiankovskii-I]
 gi|196034400|ref|ZP_03101809.1| ribosomal protein S20 [Bacillus cereus W]
 gi|196039318|ref|ZP_03106624.1| ribosomal protein S20 [Bacillus cereus NVH0597-99]
 gi|196044951|ref|ZP_03112185.1| ribosomal protein S20 [Bacillus cereus 03BB108]
 gi|206969416|ref|ZP_03230370.1| 30S ribosomal protein S20 [Bacillus cereus AH1134]
 gi|206976070|ref|ZP_03236980.1| 30S ribosomal protein S20 [Bacillus cereus H3081.97]
 gi|217961812|ref|YP_002340382.1| 30S ribosomal protein S20 [Bacillus cereus AH187]
 gi|218236085|ref|YP_002369131.1| 30S ribosomal protein S20 [Bacillus cereus B4264]
 gi|218905459|ref|YP_002453293.1| ribosomal protein S20 [Bacillus cereus AH820]
 gi|222097767|ref|YP_002531824.1| 30S ribosomal protein s20 [Bacillus cereus Q1]
 gi|225866303|ref|YP_002751681.1| 30S ribosomal protein S20 [Bacillus cereus 03BB102]
 gi|227817098|ref|YP_002817107.1| 30S ribosomal protein S20 [Bacillus anthracis str. CDC 684]
 gi|229006663|ref|ZP_04164297.1| 30S ribosomal protein S20 [Bacillus mycoides Rock1-4]
 gi|229601971|ref|YP_002868611.1| 30S ribosomal protein S20 [Bacillus anthracis str. A0248]
 gi|254684079|ref|ZP_05147939.1| 30S ribosomal protein S20 [Bacillus anthracis str. CNEVA-9066]
 gi|254736427|ref|ZP_05194133.1| 30S ribosomal protein S20 [Bacillus anthracis str. Western North
          America USA6153]
 gi|254741465|ref|ZP_05199152.1| 30S ribosomal protein S20 [Bacillus anthracis str. Kruger B]
 gi|254750903|ref|ZP_05202942.1| 30S ribosomal protein S20 [Bacillus anthracis str. Vollum]
 gi|254757769|ref|ZP_05209796.1| 30S ribosomal protein S20 [Bacillus anthracis str. Australia 94]
 gi|296504815|ref|YP_003666515.1| 30S ribosomal protein S20 [Bacillus thuringiensis BMB171]
 gi|300118686|ref|ZP_07056414.1| 30S ribosomal protein S20 [Bacillus cereus SJ1]
 gi|301055814|ref|YP_003794025.1| 30S ribosomal protein S20 [Bacillus anthracis CI]
 gi|59798638|sp|Q634L9|RS20_BACCZ RecName: Full=30S ribosomal protein S20
 gi|59798713|sp|Q6HDJ9|RS20_BACHK RecName: Full=30S ribosomal protein S20
 gi|59798781|sp|Q730L3|RS20_BACC1 RecName: Full=30S ribosomal protein S20
 gi|59798876|sp|Q818E1|RS20_BACCR RecName: Full=30S ribosomal protein S20
 gi|59798879|sp|Q81LR4|RS20_BACAN RecName: Full=30S ribosomal protein S20
 gi|226735294|sp|B7JNV4|RS20_BACC0 RecName: Full=30S ribosomal protein S20
 gi|226735296|sp|B7HCU8|RS20_BACC4 RecName: Full=30S ribosomal protein S20
 gi|226735297|sp|B7HPM1|RS20_BACC7 RecName: Full=30S ribosomal protein S20
 gi|254813042|sp|C3P8M8|RS20_BACAA RecName: Full=30S ribosomal protein S20
 gi|254813043|sp|C3L5S5|RS20_BACAC RecName: Full=30S ribosomal protein S20
 gi|254813044|sp|C1ESL6|RS20_BACC3 RecName: Full=30S ribosomal protein S20
 gi|254813045|sp|B9IY89|RS20_BACCQ RecName: Full=30S ribosomal protein S20
 gi|29897959|gb|AAP11233.1| SSU ribosomal protein S20P [Bacillus cereus ATCC 14579]
 gi|47553989|gb|EAL12356.1| ribosomal protein S20 [Bacillus cereus G9241]
 gi|164712230|gb|EDR17767.1| ribosomal protein S20 [Bacillus anthracis str. A0488]
 gi|167513412|gb|EDR88782.1| ribosomal protein S20 [Bacillus anthracis str. A0193]
 gi|167530065|gb|EDR92800.1| ribosomal protein S20 [Bacillus anthracis str. A0442]
 gi|170127652|gb|EDS96525.1| ribosomal protein S20 [Bacillus anthracis str. A0389]
 gi|170668700|gb|EDT19446.1| ribosomal protein S20 [Bacillus anthracis str. A0465]
 gi|172081523|gb|EDT66595.1| ribosomal protein S20 [Bacillus anthracis str. A0174]
 gi|190561977|gb|EDV15946.1| ribosomal protein S20 [Bacillus anthracis Tsiankovskii-I]
 gi|195992942|gb|EDX56901.1| ribosomal protein S20 [Bacillus cereus W]
 gi|196024439|gb|EDX63112.1| ribosomal protein S20 [Bacillus cereus 03BB108]
 gi|196029945|gb|EDX68546.1| ribosomal protein S20 [Bacillus cereus NVH0597-99]
 gi|206735104|gb|EDZ52272.1| 30S ribosomal protein S20 [Bacillus cereus AH1134]
 gi|206745822|gb|EDZ57219.1| 30S ribosomal protein S20 [Bacillus cereus H3081.97]
 gi|217068194|gb|ACJ82444.1| ribosomal protein S20 [Bacillus cereus AH187]
 gi|218164042|gb|ACK64034.1| ribosomal protein S20 [Bacillus cereus B4264]
 gi|218535835|gb|ACK88233.1| ribosomal protein S20 [Bacillus cereus AH820]
 gi|221241825|gb|ACM14535.1| ribosomal protein S20 (30S ribosomal protein S20) [Bacillus
          cereus Q1]
 gi|225790899|gb|ACO31116.1| 30S ribosomal protein S20 [Bacillus cereus 03BB102]
 gi|227003446|gb|ACP13189.1| 30S ribosomal protein S20 [Bacillus anthracis str. CDC 684]
 gi|228754524|gb|EEM03935.1| 30S ribosomal protein S20 [Bacillus mycoides Rock1-4]
 gi|229266379|gb|ACQ48016.1| 30S ribosomal protein S20 [Bacillus anthracis str. A0248]
 gi|296325867|gb|ADH08795.1| 30S ribosomal protein S20 [Bacillus thuringiensis BMB171]
 gi|298723935|gb|EFI64649.1| 30S ribosomal protein S20 [Bacillus cereus SJ1]
 gi|300377983|gb|ADK06887.1| 30S ribosomal protein S20 [Bacillus cereus biovar anthracis str.
          CI]
 gi|324328226|gb|ADY23486.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          finitimus YBT-020]
          Length = 85

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +    R   N S +S +RS ++     +T   +E A EA + A   + K
Sbjct: 1  MANIKSAIKRAKLSEERRAHNASIKSDMRSAVKTVEALVTNNDLENAKEAFKTASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H NAA+R+ SRL+K++
Sbjct: 61 AARKGLIHQNAAARQKSRLAKQV 83


>gi|229019547|ref|ZP_04176363.1| 30S ribosomal protein S20 [Bacillus cereus AH1273]
 gi|30259051|gb|AAP28256.1| 30S ribosomal protein S20 [Bacillus anthracis str. Ames]
 gi|47552010|gb|AAT33668.2| ribosomal protein S20 [Bacillus anthracis str. 'Ames Ancestor']
 gi|228741713|gb|EEL91897.1| 30S ribosomal protein S20 [Bacillus cereus AH1273]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +    R   N S +S +RS ++     +T   +E A EA + A   + K
Sbjct: 4  MANIKSAIKRAKLSEERRAHNASIKSDMRSAVKTVEALVTNNDLENAKEAFKTASKKLDK 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H NAA+R+ SRL+K++
Sbjct: 64 AARKGLIHQNAAARQKSRLAKQV 86


>gi|304316631|ref|YP_003851776.1| ribosomal protein S20 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302778133|gb|ADL68692.1| ribosomal protein S20 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 43/86 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    RRTL NK  +S VR+ +    + +  G I+    A   A   + K
Sbjct: 1  MANIKSAKKRILVTKRRTLENKIIKSRVRTAISKFEKNLAEGNIDNTRAALINAIRELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG  H N  +RK SRL  +   +
Sbjct: 61 AYSKGTLHRNTVARKKSRLYAKFNAL 86


>gi|330850817|ref|YP_004376567.1| 30S ribosomal protein S20 [Fistulifera sp. JPCC DA0580]
 gi|328835637|dbj|BAK18933.1| 30S ribosomal protein S20 [Fistulifera sp. JPCC DA0580]
          Length = 93

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SA+K I+   R  L N+  +SSVR+  +   + +   K  ++ E   KA+     
Sbjct: 1  MANNKSAEKRIKTNERNRLRNRLYKSSVRTLTKTFLKNLEIYKKSQSIEDKEKAQNLLNS 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRLSKRLKG 85
            S+I K   K +FH N ASRK S+L+  LK 
Sbjct: 61 IYSLIDKGTKKNVFHKNTASRKKSQLAGYLKA 92


>gi|145223252|ref|YP_001133930.1| 30S ribosomal protein S20 [Mycobacterium gilvum PYR-GCK]
 gi|315443712|ref|YP_004076591.1| 30S ribosomal protein S20P [Mycobacterium sp. Spyr1]
 gi|189044871|sp|A4T2G0|RS20_MYCGI RecName: Full=30S ribosomal protein S20
 gi|145215738|gb|ABP45142.1| SSU ribosomal protein S20P [Mycobacterium gilvum PYR-GCK]
 gi|315262015|gb|ADT98756.1| SSU ribosomal protein S20P [Mycobacterium sp. Spyr1]
          Length = 86

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K I    RR L NKS +SS+ + +R   EA+  G  E+A E        + K
Sbjct: 1  MANIKSQQKRILTNERRRLRNKSVKSSLHTAVRGFREAVESGDKEKAGELLLATSRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S L++ L  I
Sbjct: 61 AASKGVIHKNQAANRKSALARALNKI 86


>gi|293374222|ref|ZP_06620550.1| ribosomal protein S20 [Turicibacter sanguinis PC909]
 gi|325845629|ref|ZP_08168913.1| ribosomal protein S20 [Turicibacter sp. HGF1]
 gi|292647055|gb|EFF65037.1| ribosomal protein S20 [Turicibacter sanguinis PC909]
 gi|325488327|gb|EGC90752.1| ribosomal protein S20 [Turicibacter sp. HGF1]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S  K ++   +R   N S ++S+R+ ++    A+    IE A EA   A   + K
Sbjct: 1  MPNIKSQIKRVKTNDKRRQFNASFKASMRTAIKAVEVAVENKNIEAAKEAYNTANKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A+R+ SRLSK++  +
Sbjct: 61 AVAKGICHKNYAARQKSRLSKKINAL 86


>gi|260775155|ref|ZP_05884053.1| SSU ribosomal protein S20p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608856|gb|EEX35018.1| SSU ribosomal protein S20p [Vibrio coralliilyticus ATCC BAA-450]
          Length = 86

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR +  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAAIKAL 86


>gi|120609855|ref|YP_969533.1| 30S ribosomal protein S20 [Acidovorax citrulli AAC00-1]
 gi|326315997|ref|YP_004233669.1| 30S ribosomal protein S20 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|166199897|sp|A1TLC1|RS20_ACIAC RecName: Full=30S ribosomal protein S20
 gi|120588319|gb|ABM31759.1| SSU ribosomal protein S20P [Acidovorax citrulli AAC00-1]
 gi|323372833|gb|ADX45102.1| 30S ribosomal protein S20 [Acidovorax avenae subsp. avenae ATCC
          19860]
          Length = 99

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K  R+  +    N S RS  R+ +++  +A+  G   +A+E   K +SV+     KG
Sbjct: 15 SGRKRARQDVKLNAANTSLRSKYRTAVKNVEKAVLAGDKTKASELFAKMQSVVDTIADKG 74

Query: 66 IFHGNAASRKVSRLS 80
          IFH N A+R  SRLS
Sbjct: 75 IFHKNKAARDKSRLS 89


>gi|282858208|ref|ZP_06267398.1| ribosomal protein S20 [Pyramidobacter piscolens W5455]
 gi|282583939|gb|EFB89317.1| ribosomal protein S20 [Pyramidobacter piscolens W5455]
          Length = 93

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SA K +R   R  L N+  +S  ++ M+     +  G  E A      A+SV  K
Sbjct: 1  MPNKKSAIKRVRTSERNRLYNRYWKSRCKTSMKKVLATVQNGDAEAAVLQLNAAQSVFDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG+ H N A+R+ + ++ ++K +
Sbjct: 61 AVVKGVLHRNTAARRKALMTAKVKSL 86


>gi|238927971|ref|ZP_04659731.1| ribosomal protein S20 [Selenomonas flueggei ATCC 43531]
 gi|238883931|gb|EEQ47569.1| ribosomal protein S20 [Selenomonas flueggei ATCC 43531]
          Length = 103

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 11  IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
           ++  A+R   N + ++ VR  +R  N+A+  G  +EA      A   I +A +  ++H N
Sbjct: 26  VKSDAKRHARNVAEKTRVRRAIRSVNDAVAAGNADEAKTLLVAAYKSIDQAAANNVYHKN 85

Query: 71  AASRKVSRLSKRLKGI 86
           AA+RK SRL+K++  +
Sbjct: 86  AAARKKSRLAKKVNAL 101


>gi|304438639|ref|ZP_07398578.1| 30S ribosomal protein S20 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304368477|gb|EFM22163.1| 30S ribosomal protein S20 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 88

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 11 IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN 70
          ++  A+R   N + ++ VR  +R  N+A+  G  +EA      A   I +A +  ++H N
Sbjct: 11 VKSDAKRHARNVAEKTRVRRAIRSVNDAVAAGNADEAKTLLVAAYKSIDQAAANNVYHKN 70

Query: 71 AASRKVSRLSKRLKGI 86
          AA+RK SRL+K++  +
Sbjct: 71 AAARKKSRLAKKVNTL 86


>gi|17229084|ref|NP_485632.1| 30S ribosomal protein S20 [Nostoc sp. PCC 7120]
 gi|161567472|ref|YP_324699.2| 30S ribosomal protein S20 [Anabaena variabilis ATCC 29413]
 gi|20978695|sp|Q8YWL3|RS20_ANASP RecName: Full=30S ribosomal protein S20
 gi|17135412|dbj|BAB77958.1| 30S ribosomal protein S20 [Nostoc sp. PCC 7120]
          Length = 97

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SA K  +   R  + NK+ +SSV++ M++   A+         E+ ++A+     
Sbjct: 1  MANNKSALKRAQIAERNRVRNKTYKSSVKTLMKNYLSAVQAYAANPTPESKQEAQTRLAA 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            S I KA  +GI H N  +RK SRL+ +LK I  +A
Sbjct: 61 AYSRIDKAVKRGILHPNNGARKKSRLASKLKPIEQTA 97


>gi|319941609|ref|ZP_08015933.1| 30S ribosomal protein S20 [Sutterella wadsworthensis 3_1_45B]
 gi|319804839|gb|EFW01693.1| 30S ribosomal protein S20 [Sutterella wadsworthensis 3_1_45B]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R L   ++RS  R+ ++   + +  G    A EA + AES I K
Sbjct: 1  MANTKQARKRARQTVARNLHLAAQRSQYRTAIKKVRKLVAAGDKAAAQEAFKAAESTIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ HGNAA+R  SRL+  +K +
Sbjct: 61 MARKGVLHGNAAARHKSRLAAEIKAL 86


>gi|118479489|ref|YP_896640.1| 30S ribosomal protein S20 [Bacillus thuringiensis str. Al Hakam]
 gi|42739378|gb|AAS43304.1| ribosomal protein S20 [Bacillus cereus ATCC 10987]
 gi|49181144|gb|AAT56520.1| ribosomal protein S20 [Bacillus anthracis str. Sterne]
 gi|49330163|gb|AAT60809.1| ribosomal protein S20 (30S ribosomal protein S20) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51974649|gb|AAU16199.1| ribosomal protein S20 (30S ribosomal protein S20) [Bacillus cereus
           E33L]
 gi|118418714|gb|ABK87133.1| SSU ribosomal protein S20P [Bacillus thuringiensis str. Al Hakam]
          Length = 100

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SA K  +    R   N S +S +RS ++     +T   +E A EA + A   + K
Sbjct: 16  MANIKSAIKRAKLSEERRAHNASIKSDMRSAVKTVEALVTNNDLENAKEAFKTASKKLDK 75

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKG 85
           A  KG+ H NAA+R+ SRL+K++  
Sbjct: 76  AARKGLIHQNAAARQKSRLAKQVNA 100


>gi|196234271|ref|ZP_03133101.1| ribosomal protein S20 [Chthoniobacter flavus Ellin428]
 gi|196221625|gb|EDY16165.1| ribosomal protein S20 [Chthoniobacter flavus Ellin428]
          Length = 111

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  SA K  R+  RRT INK   ++V++ +++  +A+  G  ++A  A     S + K
Sbjct: 25  MANTKSAAKRARQTTRRTAINKRSLTAVKNQLKNVRDALKGGSKDKAKAAAASFFSTVDK 84

Query: 61  AKSKGIFHGNAASRKVSRLSKRL 83
           A   G  H NAA R  SRL+  L
Sbjct: 85  AVKAGRLHSNAADRHKSRLNSAL 107


>gi|15644405|ref|NP_229457.1| 30S ribosomal protein S20 [Thermotoga maritima MSB8]
 gi|170288961|ref|YP_001739199.1| ribosomal protein S20 [Thermotoga sp. RQ2]
 gi|7388181|sp|Q9X1Y7|RS20_THEMA RecName: Full=30S ribosomal protein S20
 gi|226695436|sp|B1LB18|RS20_THESQ RecName: Full=30S ribosomal protein S20
 gi|4982231|gb|AAD36724.1|AE001807_15 ribosomal protein S20 [Thermotoga maritima MSB8]
 gi|170176464|gb|ACB09516.1| ribosomal protein S20 [Thermotoga sp. RQ2]
          Length = 96

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEAT-EACRKAESVIQ 59
          M N  SAKK +R   +R L NK+ ++  ++ ++   +AI   + +E   E  RKA++ I 
Sbjct: 1  MPNIKSAKKRVRVSEKRRLRNKAYKTFFKNRIKEVLKAIENKEPKEVVLELTRKAQAAID 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          KA SKG+ H N  +R+ +RL +++   L
Sbjct: 61 KAVSKGVIHKNQGARRKARLFEKVNEYL 88


>gi|332283939|ref|YP_004415850.1| 30S ribosomal protein S20 [Pusillimonas sp. T7-7]
 gi|330427892|gb|AEC19226.1| 30S ribosomal protein S20 [Pusillimonas sp. T7-7]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N S RS +R+ ++   +AI  G    A E  +K  S+I +
Sbjct: 1  MANTAQARKRARQSVERNKHNASLRSMLRTSIKRVRQAIEAGDKAVAAEVFQKTTSIIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 61 VADKNIIHKNKAARHKSRLAAAVKAL 86


>gi|257784605|ref|YP_003179822.1| 30S ribosomal protein S20 [Atopobium parvulum DSM 20469]
 gi|257473112|gb|ACV51231.1| ribosomal protein S20 [Atopobium parvulum DSM 20469]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +    NK+ RS +++ ++    A+  G++E+A  A  KA  ++ K
Sbjct: 1  MANIKSQKKRILTAEKARQRNKAVRSELKTAIKAVRTAVEAGQLEDAQVAANKASRLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKGI H N A+++ S + K
Sbjct: 61 AASKGIVHKNQAAQRKSGVQK 81


>gi|281417759|ref|ZP_06248779.1| ribosomal protein S20 [Clostridium thermocellum JW20]
 gi|281409161|gb|EFB39419.1| ribosomal protein S20 [Clostridium thermocellum JW20]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +R   ++TL N  R+S +++ ++   +AI   +   A EA + A   I K
Sbjct: 1  MPNIKSAIKRVRISKKKTLQNSMRKSILKTNIKKCKQAIANNE-PNAVEALKLAIKTIDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A +K I H N A+RK S+L K L   L
Sbjct: 60 AAAKNIIHKNTAARKKSKLVKALNAAL 86


>gi|227874747|ref|ZP_03992900.1| ribosomal protein S20 [Mobiluncus mulieris ATCC 35243]
 gi|269976837|ref|ZP_06183812.1| ribosomal protein S20 [Mobiluncus mulieris 28-1]
 gi|306818043|ref|ZP_07451774.1| 30S ribosomal protein S20 [Mobiluncus mulieris ATCC 35239]
 gi|307699753|ref|ZP_07636808.1| ribosomal protein S20 [Mobiluncus mulieris FB024-16]
 gi|227844522|gb|EEJ54678.1| ribosomal protein S20 [Mobiluncus mulieris ATCC 35243]
 gi|269935034|gb|EEZ91593.1| ribosomal protein S20 [Mobiluncus mulieris 28-1]
 gi|304649007|gb|EFM46301.1| 30S ribosomal protein S20 [Mobiluncus mulieris ATCC 35239]
 gi|307615056|gb|EFN94270.1| ribosomal protein S20 [Mobiluncus mulieris FB024-16]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K IR   +  L N+S +S +++F+R   EA+  G    A  A R A   +  
Sbjct: 1  MANIKSQMKRIRTNEKARLRNQSVKSELKTFVRKTREAVVAGDKTAAESALRVATRKLDV 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKGI H N A+++ S+L+
Sbjct: 61 AASKGIIHKNQAAQRKSKLA 80


>gi|259047452|ref|ZP_05737853.1| 30S ribosomal protein S20 [Granulicatella adiacens ATCC 49175]
 gi|259035643|gb|EEW36898.1| 30S ribosomal protein S20 [Granulicatella adiacens ATCC 49175]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          + N  S  K +R   + TL N S+ S++R+ ++    A+  G  E A E  R A   I  
Sbjct: 4  LPNIASQIKRVRTNKKSTLANNSQTSAMRTAIKKFEAAVAEG-AENAEELLRAAHKAIDG 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N ASR  SRL+ +L
Sbjct: 63 AASKGLIHKNKASRDKSRLAAKL 85


>gi|169628724|ref|YP_001702373.1| 30s ribosomal protein S20 [Mycobacterium abscessus ATCC 19977]
 gi|226736524|sp|B1MN07|RS20_MYCA9 RecName: Full=30S ribosomal protein S20
 gi|169240691|emb|CAM61719.1| 30s ribosomal protein S20 [Mycobacterium abscessus]
          Length = 86

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K IR   R  L N++ +SS+R+ +R   EAI  G  E+A E        + K
Sbjct: 1  MANIKSQEKRIRTNERARLRNQATKSSLRTAIRGLREAIAEGDKEKAGELLVSTSRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A +KG+ H N A+ K S L+
Sbjct: 61 AVTKGVIHKNQAANKKSALA 80


>gi|242279451|ref|YP_002991580.1| 30S ribosomal protein S20 [Desulfovibrio salexigens DSM 2638]
 gi|259494858|sp|C6BV66|RS20_DESAD RecName: Full=30S ribosomal protein S20
 gi|242122345|gb|ACS80041.1| ribosomal protein S20 [Desulfovibrio salexigens DSM 2638]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 46/80 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +R L N   R+ +++ ++    A+     E A  A RKA SV+ K
Sbjct: 1  MANHKSALKRHRQSIKRNLRNNMVRTRIKNVVKEVRSAVEANDTELAATALRKATSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A +K + H  AA+R++SRLS
Sbjct: 61 AATKKVIHARAAARRISRLS 80


>gi|254721913|ref|ZP_05183702.1| 30S ribosomal protein S20 [Bacillus anthracis str. A1055]
          Length = 85

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +    R   N S +S +RS ++     +T   +E A EA + A   + K
Sbjct: 1  MANIKSAIKRSKLSEERRAHNASIKSDMRSAVKTVEALVTNNDLENAKEAFKTASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H NAA+R+ SRL+K++
Sbjct: 61 AARKGLIHQNAAARQKSRLAKQV 83


>gi|296121121|ref|YP_003628899.1| ribosomal protein S20 [Planctomyces limnophilus DSM 3776]
 gi|296013461|gb|ADG66700.1| ribosomal protein S20 [Planctomyces limnophilus DSM 3776]
          Length = 104

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHA----NEAITFGKIEEATEACRKAES 56
          M N D A++ +RK  +R   N+  RS +R+ ++         +T G +++AT   R A  
Sbjct: 1  MPNSDGARRSLRKQLKRRAANRVLRSVLRTTVKKTRLTFTAVVTGGPVDDATTQLRVAIK 60

Query: 57 VIQKAKSKGIFHGNAASRKVSRLS 80
           I +  ++G+ H N A+R  SRL+
Sbjct: 61 KIDQMAARGLIHKNKAARDKSRLT 84


>gi|225593150|gb|ACN96068.1| 30S ribosomal protein S20 [Fischerella sp. MV11]
          Length = 100

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFG-----KIEEATEA-CRK 53
          MAN  SA K  +   R  L NK+ +S+V++ M+    A+ T+      ++++  +A   +
Sbjct: 1  MANTKSALKRAKIAERNRLRNKAYKSAVKTLMKKYFAAVETYAANPTPELQQEVQARMSE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA  +G+ H N  +RK SRL++RLK     A
Sbjct: 61 AYSKIDKAVKRGVLHPNNGARKKSRLAQRLKAYTQPA 97


>gi|71893593|ref|YP_279039.1| 30S ribosomal protein S20 [Mycoplasma hyopneumoniae J]
 gi|115305690|sp|Q4AA93|RS20_MYCHJ RecName: Full=30S ribosomal protein S20
 gi|71851720|gb|AAZ44328.1| 30S ribosomal protein S20 [Mycoplasma hyopneumoniae J]
          Length = 90

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I K+ +    N + +S V++ ++ A  AI+       ++   KA S I K
Sbjct: 1  MANIKSKIKSITKMQKARAKNNAIKSRVKTAIKKAKIAISTD-ASNKSDLIAKAHSEISK 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          AKSKG+FH N A+RK+SRL+
Sbjct: 60 AKSKGVFHKNKANRKISRLN 79


>gi|332982228|ref|YP_004463669.1| 30S ribosomal protein S20P [Mahella australiensis 50-1 BON]
 gi|332699906|gb|AEE96847.1| SSU ribosomal protein S20P [Mahella australiensis 50-1 BON]
          Length = 88

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I      TL NK+ +S +++ ++     +  G  E A  A  +A S+I K
Sbjct: 1  MANIKSAKKRIEIAKANTLRNKANKSRMKTAIKKFEMTLANGDTENARRAYTEAISIIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI H N A+R  + L+ +L  +
Sbjct: 61 TASKGIIHKNKAARHKAALAFKLNAV 86


>gi|57233691|ref|YP_182332.1| 30S ribosomal protein S20 [Dehalococcoides ethenogenes 195]
 gi|270308886|ref|YP_003330944.1| ribosomal protein S20 [Dehalococcoides sp. VS]
 gi|115305680|sp|Q3Z617|RS20_DEHE1 RecName: Full=30S ribosomal protein S20
 gi|57224139|gb|AAW39196.1| ribosomal protein S20 [Dehalococcoides ethenogenes 195]
 gi|270154778|gb|ACZ62616.1| ribosomal protein S20 [Dehalococcoides sp. VS]
          Length = 88

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA+K +R        N+  +S V++ +    + +  G + EA  A   A+S + K
Sbjct: 1  MPNTKSAEKALRVADANRQENRRAKSQVKTSLTKVKKLVDAGSLTEAEAAAVSAQSTLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KGI H   A+R+ SRL K+L
Sbjct: 61 AAEKGILHPKNAARRKSRLMKKL 83


>gi|149921245|ref|ZP_01909701.1| SSU ribosomal protein S20 [Plesiocystis pacifica SIR-1]
 gi|149817905|gb|EDM77367.1| SSU ribosomal protein S20 [Plesiocystis pacifica SIR-1]
          Length = 112

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (52%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN   A+K  R+  +R   N    S++R++++    AI  G +E A     +A   I K
Sbjct: 23  MANHKQAEKRNRQRLKRRARNLLHLSTMRTYIKRVRRAIEEGDLETAQSTLPQALHAIGK 82

Query: 61  AKSKGIFHGNAASRKVSRLS 80
           A SKG+ H   ASR  SRL+
Sbjct: 83  ANSKGVIHRRTASRYASRLT 102


>gi|308048497|ref|YP_003912063.1| 30S ribosomal protein S20P [Ferrimonas balearica DSM 9799]
 gi|307630687|gb|ADN74989.1| SSU ribosomal protein S20P [Ferrimonas balearica DSM 9799]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F +    AI  G    ATEA   A+ ++ +
Sbjct: 1  MANIKSAKKRAIQAEKRRQHNASRRSMMRTFTKKVVAAIATGDKAAATEAFNAAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLAAQIKAL 86


>gi|119504224|ref|ZP_01626304.1| ribosomal protein S20p [marine gamma proteobacterium HTCC2080]
 gi|119459732|gb|EAW40827.1| ribosomal protein S20p [marine gamma proteobacterium HTCC2080]
          Length = 89

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S RS VR+ ++H   AI  G  + ++ A   A  VI K
Sbjct: 1  MANSPQARKRARQNDKRRARNSSLRSLVRTKIKHVIAAIGTGDFDASSAAYAAAVPVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGI   N A+R  SRL+ ++K +
Sbjct: 61 MVTKGIIEKNKAARHKSRLNAKVKAL 86


>gi|117618088|ref|YP_855221.1| ribosomal protein S20 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|330831176|ref|YP_004394128.1| 30S ribosomal protein S20 [Aeromonas veronii B565]
 gi|166200007|sp|A0KG36|RS20_AERHH RecName: Full=30S ribosomal protein S20
 gi|117559495|gb|ABK36443.1| ribosomal protein S20 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|328806312|gb|AEB51511.1| 30S ribosomal protein S20 [Aeromonas veronii B565]
          Length = 87

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS  R++++    AI  G    AT A   A+ ++ +
Sbjct: 1  MANIKSAKKRALQSEKRRQHNASRRSMTRTYLKKVIAAIASGDKAAATAAFAVAQPIMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRLS ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLSAQIKAM 86


>gi|325283416|ref|YP_004255957.1| 30S ribosomal protein S20 [Deinococcus proteolyticus MRP]
 gi|324315225|gb|ADY26340.1| 30S ribosomal protein S20 [Deinococcus proteolyticus MRP]
          Length = 101

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 2/75 (2%)

Query: 5  DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSK 64
           SA+K  R+  +R + N+S++S++++F + A  A+  G      E  +KAES+I KA   
Sbjct: 14 PSAQKRHRQSLKRRMRNRSKKSTIKTFSKKALMAVQEGG--NVAELQQKAESLIDKAAKG 71

Query: 65 GIFHGNAASRKVSRL 79
             H NAA+RK SRL
Sbjct: 72 STLHKNAAARKKSRL 86


>gi|160940355|ref|ZP_02087700.1| hypothetical protein CLOBOL_05245 [Clostridium bolteae ATCC
          BAA-613]
 gi|158436935|gb|EDP14702.1| hypothetical protein CLOBOL_05245 [Clostridium bolteae ATCC
          BAA-613]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I     +   NK+ RS V++ ++  + A+  G    A  A   A + I K
Sbjct: 1  MANIKSAKKRILVNETKAARNKAIRSKVKTAIKKVDAAVAAGDKAAAQAALLAATTEIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H N ASRKVSRLSK +  I
Sbjct: 61 AATKGVYHKNNASRKVSRLSKAVNSI 86


>gi|169824483|ref|YP_001692094.1| 30S ribosomal protein S20 [Finegoldia magna ATCC 29328]
 gi|302380553|ref|ZP_07269018.1| ribosomal protein S20 [Finegoldia magna ACS-171-V-Col3]
 gi|303233824|ref|ZP_07320478.1| ribosomal protein S20 [Finegoldia magna BVS033A4]
 gi|226736498|sp|B0S1G4|RS20_FINM2 RecName: Full=30S ribosomal protein S20
 gi|167831288|dbj|BAG08204.1| 30S ribosomal protein S20 [Finegoldia magna ATCC 29328]
 gi|302311496|gb|EFK93512.1| ribosomal protein S20 [Finegoldia magna ACS-171-V-Col3]
 gi|302495258|gb|EFL55010.1| ribosomal protein S20 [Finegoldia magna BVS033A4]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I      T  NKS++S++++F++    AI     E+AT+    A   I +
Sbjct: 1  MANIKSAIKRIDVTKLETARNKSKKSAIKTFIKKFEAAIEKNDKEDATKLFNLATKKIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SK     N+A++K+SR++K L
Sbjct: 61 AASKNTISKNSAAKKISRMAKEL 83


>gi|225388453|ref|ZP_03758177.1| hypothetical protein CLOSTASPAR_02189 [Clostridium asparagiforme
          DSM 15981]
 gi|225045482|gb|EEG55728.1| hypothetical protein CLOSTASPAR_02189 [Clostridium asparagiforme
          DSM 15981]
          Length = 95

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NK+ RS V++ ++    A+  G    A  A   A S I K
Sbjct: 9  LANIKSAKKRILVNETKAARNKAIRSKVKTMVKKVEAAVAAGDKAAAQAALLAATSEIDK 68

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H N ASRKVSRLSK +  I
Sbjct: 69 ATTKGVYHKNTASRKVSRLSKAVNSI 94


>gi|149196190|ref|ZP_01873245.1| SSU ribosomal protein S20P [Lentisphaera araneosa HTCC2155]
 gi|149140451|gb|EDM28849.1| SSU ribosomal protein S20P [Lentisphaera araneosa HTCC2155]
          Length = 88

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAK+ IR   ++ + NK+R+S++ +  +  N A+T G  EEA +A +   S   +
Sbjct: 1  MAHAPSAKRHIRADEKKRVRNKARKSAITTLEKKFNAALTEGNTEEAKKALQVCFSAYDR 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  KG+     A R+ SRL+
Sbjct: 61 AVKKGVVKRATADRRKSRLN 80


>gi|33519591|ref|NP_878423.1| 30S ribosomal protein S20 [Candidatus Blochmannia floridanus]
 gi|59798861|sp|Q7VQL2|RS20_BLOFL RecName: Full=30S ribosomal protein S20
 gi|33517254|emb|CAD83637.1| 30S ribosomal protein S20 [Candidatus Blochmannia floridanus]
          Length = 88

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I K  +    N S RS +++F++  N AI    I EA  A +  +  I +
Sbjct: 1  MANTKSAKKFIIKSKKNRNRNLSNRSMLKTFIKKVNIAINKRNISEALFAFKNMQKCIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
             KG+ H N A+R  S++ +R+
Sbjct: 61 QSIKGLIHKNKAARCKSKIFRRI 83


>gi|256003373|ref|ZP_05428364.1| ribosomal protein S20 [Clostridium thermocellum DSM 2360]
 gi|255992663|gb|EEU02754.1| ribosomal protein S20 [Clostridium thermocellum DSM 2360]
 gi|316940204|gb|ADU74238.1| ribosomal protein S20 [Clostridium thermocellum DSM 1313]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +R   ++TL N  R+S +++ ++   +AI   +   A EA + A   I K
Sbjct: 1  MPNIKSAIKRVRISKKKTLQNSMRKSILKTNIKKCKQAIANNE-PNAVEALKLAIKTIDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A +K I H N A+RK S+L K L   L
Sbjct: 60 AAAKNIIHKNTAARKKSKLVKALNTAL 86


>gi|54020357|ref|YP_115649.1| 30S ribosomal protein S20 [Mycoplasma hyopneumoniae 232]
 gi|72080584|ref|YP_287642.1| 30S ribosomal protein S20 [Mycoplasma hyopneumoniae 7448]
 gi|59798623|sp|Q601R6|RS20_MYCH2 RecName: Full=30S ribosomal protein S20
 gi|115305689|sp|Q4A8C0|RS20_MYCH7 RecName: Full=30S ribosomal protein S20
 gi|53987530|gb|AAV27731.1| 30s ribosomal protein S20 [Mycoplasma hyopneumoniae 232]
 gi|71913708|gb|AAZ53619.1| 30S ribosomal protein S20 [Mycoplasma hyopneumoniae 7448]
 gi|312601219|gb|ADQ90474.1| 30S ribosomal protein S20 [Mycoplasma hyopneumoniae 168]
          Length = 90

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I K+ +    N + +S V++ ++ A  AI+       ++   KA S I K
Sbjct: 1  MANIKSKIKSITKMQKARARNNAIKSRVKTAIKKAKIAISTD-ASNKSDLIAKAHSEISK 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          AKSKG+FH N A+RK+SRL+
Sbjct: 60 AKSKGVFHKNKANRKISRLN 79


>gi|77359862|ref|YP_339437.1| 30S ribosomal subunit protein S20 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|332532153|ref|ZP_08408036.1| 30S ribosomal protein S20 [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|110825787|sp|Q3IEA5|RS20_PSEHT RecName: Full=30S ribosomal protein S20
 gi|76874773|emb|CAI85994.1| 30S ribosomal subunit protein S20 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|332038494|gb|EGI74938.1| 30S ribosomal protein S20 [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +    N SRRS +R++ +    AI  G  E A +A   A  ++ +
Sbjct: 1  MANIKSAKKRAITSEKNRQHNASRRSMMRTYFKKVIVAIEAGDKEAAQQAFSVATPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR++ ++K +
Sbjct: 61 YATKGLIHKNKAARHKSRIAAKIKAL 86


>gi|300115552|ref|YP_003762127.1| 30S ribosomal protein S20 [Nitrosococcus watsonii C-113]
 gi|299541489|gb|ADJ29806.1| ribosomal protein S20 [Nitrosococcus watsonii C-113]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 46/84 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N  +RS +R++++   +A+  G   +A  A ++A  ++ +
Sbjct: 1  MANTSQARKRARQAVVRRARNAGQRSMMRTYVKKIVKAVVSGDKSQAVAAYQEAVPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
             KG+ H N  +R  SRL+ R++
Sbjct: 61 LARKGLVHPNKVARHKSRLNARIR 84


>gi|238810264|dbj|BAH70054.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 68

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSK 81
          ++ VR  +R A EAI   K + A E   KA S+I  A  KG+FH N  +RK SRL K
Sbjct: 2  KTRVRKAIRVAREAI-LAKDKNAQELVNKAHSIIATAVQKGVFHPNKGARKSSRLDK 57


>gi|152979760|ref|YP_001345389.1| 30S ribosomal protein S20 [Actinobacillus succinogenes 130Z]
 gi|226735288|sp|A6VR57|RS20_ACTSZ RecName: Full=30S ribosomal protein S20
 gi|150841483|gb|ABR75454.1| ribosomal protein S20 [Actinobacillus succinogenes 130Z]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++    A+  G+   A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAAVAAGEKSAAQAAFLEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+LS ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLSAQIKKL 86


>gi|317128292|ref|YP_004094574.1| ribosomal protein S20 [Bacillus cellulosilyticus DSM 2522]
 gi|315473240|gb|ADU29843.1| ribosomal protein S20 [Bacillus cellulosilyticus DSM 2522]
          Length = 88

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K ++   +R   N + +S +R+ ++  N       +E A +A   A   + K
Sbjct: 1  MANIKSAIKRVKTTEKRRAQNAAFKSDLRTAIKAFNAKAESNDVEGAKQAFLVATKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAA+R+ S L KRL  +
Sbjct: 61 AANKGLLHKNAANRQKSNLQKRLNSV 86


>gi|261856610|ref|YP_003263893.1| ribosomal protein S20 [Halothiobacillus neapolitanus c2]
 gi|261837079|gb|ACX96846.1| ribosomal protein S20 [Halothiobacillus neapolitanus c2]
          Length = 90

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK +R+  +    N + R+ VR+  +   +A+  G  E+A  A + A+ VI  
Sbjct: 1  MANTAQAKKRVRQAEQARQRNMALRTRVRTEYKKVLKAVATGNAEQAKTAYQSAQPVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +KGI   N A+R+ S L  R+K +  +A
Sbjct: 61 MVNKGILAKNTAARRKSTLVARIKSMSAAA 90


>gi|73749411|ref|YP_308650.1| 30S ribosomal protein S20 [Dehalococcoides sp. CBDB1]
 gi|147670020|ref|YP_001214838.1| 30S ribosomal protein S20 [Dehalococcoides sp. BAV1]
 gi|289433369|ref|YP_003463242.1| ribosomal protein S20 [Dehalococcoides sp. GT]
 gi|115305681|sp|Q3ZZW3|RS20_DEHSC RecName: Full=30S ribosomal protein S20
 gi|189044860|sp|A5FPB2|RS20_DEHSB RecName: Full=30S ribosomal protein S20
 gi|73661127|emb|CAI83734.1| ribosomal protein S20 [Dehalococcoides sp. CBDB1]
 gi|146270968|gb|ABQ17960.1| SSU ribosomal protein S20P [Dehalococcoides sp. BAV1]
 gi|288947089|gb|ADC74786.1| ribosomal protein S20 [Dehalococcoides sp. GT]
          Length = 88

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA+K +R        N+  +S V++ +    + +  G I EA  A   A+S + K
Sbjct: 1  MPNTKSAEKALRVADANRQENRRAKSQVKTSLTKVKKLVDAGSINEAETAAVSAQSNLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KGI H   A+R+ SRL K+L
Sbjct: 61 AAEKGIIHPKNAARRKSRLMKKL 83


>gi|156743134|ref|YP_001433263.1| 30S ribosomal protein S20 [Roseiflexus castenholzii DSM 13941]
 gi|156234462|gb|ABU59245.1| ribosomal protein S20 [Roseiflexus castenholzii DSM 13941]
          Length = 68

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          RS V++ +R A  AI  G  E   E  R+A S++ +A  KGI H N A+R+ SRL+K+L
Sbjct: 3  RSRVKTAIRKAERAIFAGAPEP--ELVREAMSLLDRAAVKGIIHKNNAARRKSRLAKKL 59


>gi|86739968|ref|YP_480368.1| 30S ribosomal protein S20 [Frankia sp. CcI3]
 gi|108884801|sp|Q2JDK3|RS20_FRASC RecName: Full=30S ribosomal protein S20
 gi|86566830|gb|ABD10639.1| SSU ribosomal protein S20P [Frankia sp. CcI3]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L NK+ +S +++ +R   +A+  G +E A E  R A   + KA SKG+ H N A+ K
Sbjct: 16 KRRLRNKAVKSELKTHVRRFRDAVDAGDVERAGETLRIASRKLDKAVSKGVIHANQAANK 75

Query: 76 VSRLSK 81
           S L++
Sbjct: 76 KSALAR 81


>gi|329904091|ref|ZP_08273669.1| SSU ribosomal protein S20p [Oxalobacteraceae bacterium IMCC9480]
 gi|327548145|gb|EGF32860.1| SSU ribosomal protein S20p [Oxalobacteraceae bacterium IMCC9480]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S+RS++R+ ++   +AI  G    AT+  + + SVI +
Sbjct: 1  MANTAQARKRARQAVKQNAHNSSQRSTLRTAIKAIRKAIEGGDKAVATQVFQSSISVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SR++  LK +
Sbjct: 61 IADKKIIHKNKAARHKSRMAAALKAL 86


>gi|163942078|ref|YP_001646962.1| 30S ribosomal protein S20 [Bacillus weihenstephanensis KBAB4]
 gi|226735298|sp|A9VHU9|RS20_BACWK RecName: Full=30S ribosomal protein S20
 gi|163864275|gb|ABY45334.1| ribosomal protein S20 [Bacillus weihenstephanensis KBAB4]
          Length = 85

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +    R   N S +S +R+ ++     +T   +E A EA + A   + K
Sbjct: 1  MANIKSAIKRAKLSEERRSHNASIKSDMRTAVKTVETLVTNNDLENAKEAFKTASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H NAA+R+ SRL+K++
Sbjct: 61 AARKGLIHQNAAARQKSRLAKQV 83


>gi|218246585|ref|YP_002371956.1| 30S ribosomal protein S20 [Cyanothece sp. PCC 8801]
 gi|257059627|ref|YP_003137515.1| 30S ribosomal protein S20 [Cyanothece sp. PCC 8802]
 gi|226736480|sp|B7JWV1|RS20_CYAP8 RecName: Full=30S ribosomal protein S20
 gi|218167063|gb|ACK65800.1| ribosomal protein S20 [Cyanothece sp. PCC 8801]
 gi|256589793|gb|ACV00680.1| ribosomal protein S20 [Cyanothece sp. PCC 8802]
          Length = 97

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFGKIEEA-----TEACRK- 53
          MAN  SA K I    R  L NK+ +S+VR+ M+   EA+  +G           E C   
Sbjct: 1  MANSKSALKRIAVAERNRLHNKAYKSAVRTLMKKYFEAVQAYGNNPTPDNLSVVEQCMSA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA  + + H N  +RK +RL+K LK + T++
Sbjct: 61 AYSKIDKAVKRHVLHRNNGARKKARLAKALKQVATAS 97


>gi|107099774|ref|ZP_01363692.1| hypothetical protein PaerPA_01000792 [Pseudomonas aeruginosa
          PACS2]
          Length = 65

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          VR+++++  +AI    +E+A  A   A  VI +   KGI H N A+R  SRLS  +K + 
Sbjct: 2  VRTYIKNVVKAIDAKDLEKAQAAFTAAVPVIDRMADKGIIHKNKAARHKSRLSGHIKALS 61

Query: 88 TSA 90
          T+A
Sbjct: 62 TAA 64


>gi|295838950|ref|ZP_06825883.1| ribosomal protein S20 [Streptomyces sp. SPB74]
 gi|197695505|gb|EDY42438.1| ribosomal protein S20 [Streptomyces sp. SPB74]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G +E+A E  R A   + KA S G+ H N A+ K S 
Sbjct: 19 LRNKAVKSSLKTAIRKAREATAAGDVEKAQELTRLATRKLDKAVSSGVIHKNQAANKKSA 78

Query: 79 LS 80
          L+
Sbjct: 79 LA 80


>gi|260771137|ref|ZP_05880064.1| SSU ribosomal protein S20p [Vibrio furnissii CIP 102972]
 gi|260613734|gb|EEX38926.1| SSU ribosomal protein S20p [Vibrio furnissii CIP 102972]
 gi|315179257|gb|ADT86171.1| 30S ribosomal protein S20 [Vibrio furnissii NCTC 11218]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANCKSAKKRAIQSEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR +  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAAIKAL 86


>gi|2632000|emb|CAA05374.1| RpsT protein [Vibrio cholerae]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANNKSAKKRAIQAEKRRQDNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
            +KG+ H N A+R  SR 
Sbjct: 61 MATKGLIHKNKAARHKSRF 79


>gi|145297751|ref|YP_001140592.1| 30S ribosomal protein S20 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|166200008|sp|A4SIX2|RS20_AERS4 RecName: Full=30S ribosomal protein S20
 gi|142850523|gb|ABO88844.1| ribosomal protein S20 [Aeromonas salmonicida subsp. salmonicida
          A449]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS  R++++    AI  G    A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAIQSEKRRQHNASRRSMTRTYLKKVIAAIASGDKAAAVAAFATAQPIMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRLS ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLSAQIKAM 86


>gi|291295234|ref|YP_003506632.1| 30S ribosomal protein S20 [Meiothermus ruber DSM 1279]
 gi|290470193|gb|ADD27612.1| ribosomal protein S20 [Meiothermus ruber DSM 1279]
          Length = 97

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 46/89 (51%)

Query: 2  ANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKA 61
          A   SA K  R+  +R   NKS+ S++++  + A      G   EA    R AES+I KA
Sbjct: 7  ARNPSAMKRHRQSLKRRARNKSKMSAIKTVSKKAVALAKEGNASEAVRVMRYAESLIDKA 66

Query: 62 KSKGIFHGNAASRKVSRLSKRLKGILTSA 90
                H NAASR+ SRL  ++  +L+ A
Sbjct: 67 AKGSTLHKNAASRRKSRLMSKVHQLLSGA 95


>gi|186685074|ref|YP_001868270.1| 30S ribosomal protein S20 [Nostoc punctiforme PCC 73102]
 gi|186467526|gb|ACC83327.1| ribosomal protein S20 [Nostoc punctiforme PCC 73102]
          Length = 110

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-------TFGKIEEATEACRK 53
           +AN  SA K  +   R  L NK+ +S+V++ M+  + A+       T    EEA     +
Sbjct: 12  VANTKSALKRAQIAERNRLRNKAYKSAVKTLMKKYSNAVAVYAANPTPELQEEAQARLSE 71

Query: 54  AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
           A   I KA  +G+ H N  +RK SRL+ +LK I  +A
Sbjct: 72  AYGKIDKAVKRGVLHPNNGARKKSRLAHKLKPITQTA 108


>gi|297588462|ref|ZP_06947105.1| 30S ribosomal protein S20 [Finegoldia magna ATCC 53516]
 gi|297573835|gb|EFH92556.1| 30S ribosomal protein S20 [Finegoldia magna ATCC 53516]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I      T  NKS++S++++F++    A+     E+AT+    A   I +
Sbjct: 1  MANIKSAIKRIDVTKLETARNKSKKSAIKTFIKKFEAAVEKNDKEDATKLFNLATKKIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SK     N+A++K+SR++K L
Sbjct: 61 AASKNTISKNSAAKKISRMAKEL 83


>gi|158313939|ref|YP_001506447.1| ribosomal protein S20 [Frankia sp. EAN1pec]
 gi|158109344|gb|ABW11541.1| ribosomal protein S20 [Frankia sp. EAN1pec]
          Length = 107

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L NK+ +S +++ +R   +A+  G +E A  A R A   + KA SKG+ H N A+ +
Sbjct: 34 KRRLRNKAVKSELKTHVRRFRDAVEAGDVERAESALRIASKKLDKAASKGVIHPNQAANR 93

Query: 76 VSRLSK 81
           S L+K
Sbjct: 94 KSALAK 99


>gi|18311024|ref|NP_562958.1| 30S ribosomal protein S20 [Clostridium perfringens str. 13]
 gi|20978679|sp|Q8XIS2|RS20_CLOPE RecName: Full=30S ribosomal protein S20
 gi|18145706|dbj|BAB81748.1| 30S ribosomal protein S20 [Clostridium perfringens str. 13]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+   ++TL NK  +S++++ ++    A+      EA     +A   +  
Sbjct: 1  MANIKSAKKRIKVTEKKTLRNKMIKSALKTAIKKFEVAVQANNKAEAATLYVEAARALDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SKG+ H N A+RK SRL+ +L  +
Sbjct: 61 SASKGVVHKNMAARKKSRLAAKLNAM 86


>gi|325982429|ref|YP_004294831.1| 30S ribosomal protein S20 [Nitrosomonas sp. AL212]
 gi|325531948|gb|ADZ26669.1| ribosomal protein S20 [Nitrosomonas sp. AL212]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 43/84 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S RS +R+ +++  +AI  G    A  A   + S I  
Sbjct: 1  MANSAQARKRARQAVKRREYNVSLRSKLRTAIKYVRKAIGSGDKGLAQNAFNNSISTIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
             KGI H N A+R  SRLS  +K
Sbjct: 61 ITGKGIIHKNKAARYKSRLSSAIK 84


>gi|15640698|ref|NP_230328.1| 30S ribosomal protein S20 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|147673748|ref|YP_001216174.1| 30S ribosomal protein S20 [Vibrio cholerae O395]
 gi|153826536|ref|ZP_01979203.1| ribosomal protein S20 [Vibrio cholerae MZO-2]
 gi|227080860|ref|YP_002809411.1| ribosomal protein S20 [Vibrio cholerae M66-2]
 gi|254851011|ref|ZP_05240361.1| ribosomal protein S20 [Vibrio cholerae MO10]
 gi|255743862|ref|ZP_05417818.1| SSU ribosomal protein S20p [Vibrio cholera CIRS 101]
 gi|258620347|ref|ZP_05715385.1| 30S ribosomal protein S20 [Vibrio mimicus VM573]
 gi|258624719|ref|ZP_05719653.1| 30S ribosomal protein S20 [Vibrio mimicus VM603]
 gi|261212211|ref|ZP_05926497.1| SSU ribosomal protein S20p [Vibrio sp. RC341]
 gi|262156081|ref|ZP_06029200.1| SSU ribosomal protein S20p [Vibrio cholerae INDRE 91/1]
 gi|262163909|ref|ZP_06031648.1| SSU ribosomal protein S20p [Vibrio mimicus VM223]
 gi|262169978|ref|ZP_06037668.1| SSU ribosomal protein S20p [Vibrio cholerae RC27]
 gi|262172244|ref|ZP_06039922.1| SSU ribosomal protein S20p [Vibrio mimicus MB-451]
 gi|262401622|ref|ZP_06078188.1| SSU ribosomal protein S20p [Vibrio sp. RC586]
 gi|297580803|ref|ZP_06942729.1| ribosomal protein S20 [Vibrio cholerae RC385]
 gi|298500793|ref|ZP_07010596.1| SSU ribosomal protein S20 [Vibrio cholerae MAK 757]
 gi|12644059|sp|O34239|RS20_VIBCH RecName: Full=30S ribosomal protein S20
 gi|172047694|sp|A5F8Z0|RS20_VIBC3 RecName: Full=30S ribosomal protein S20
 gi|254813073|sp|C3LST4|RS20_VIBCM RecName: Full=30S ribosomal protein S20
 gi|9655118|gb|AAF93844.1| ribosomal protein S20 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|146315631|gb|ABQ20170.1| ribosomal protein S20 [Vibrio cholerae O395]
 gi|149739716|gb|EDM53923.1| ribosomal protein S20 [Vibrio cholerae MZO-2]
 gi|227008748|gb|ACP04960.1| ribosomal protein S20 [Vibrio cholerae M66-2]
 gi|227012504|gb|ACP08714.1| ribosomal protein S20 [Vibrio cholerae O395]
 gi|254846716|gb|EET25130.1| ribosomal protein S20 [Vibrio cholerae MO10]
 gi|255738493|gb|EET93882.1| SSU ribosomal protein S20p [Vibrio cholera CIRS 101]
 gi|258583006|gb|EEW07821.1| 30S ribosomal protein S20 [Vibrio mimicus VM603]
 gi|258587226|gb|EEW11937.1| 30S ribosomal protein S20 [Vibrio mimicus VM573]
 gi|260838819|gb|EEX65470.1| SSU ribosomal protein S20p [Vibrio sp. RC341]
 gi|261893320|gb|EEY39306.1| SSU ribosomal protein S20p [Vibrio mimicus MB-451]
 gi|262021712|gb|EEY40423.1| SSU ribosomal protein S20p [Vibrio cholerae RC27]
 gi|262027437|gb|EEY46103.1| SSU ribosomal protein S20p [Vibrio mimicus VM223]
 gi|262030117|gb|EEY48762.1| SSU ribosomal protein S20p [Vibrio cholerae INDRE 91/1]
 gi|262352039|gb|EEZ01169.1| SSU ribosomal protein S20p [Vibrio sp. RC586]
 gi|297535219|gb|EFH74054.1| ribosomal protein S20 [Vibrio cholerae RC385]
 gi|297540574|gb|EFH76632.1| SSU ribosomal protein S20 [Vibrio cholerae MAK 757]
 gi|327483479|gb|AEA77886.1| SSU ribosomal protein S20p [Vibrio cholerae LMA3894-4]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 1  MANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
            +KG+ H N A+R  SR 
Sbjct: 61 MATKGLIHKNKAARHKSRF 79


>gi|95930685|ref|ZP_01313419.1| ribosomal protein S20 [Desulfuromonas acetoxidans DSM 684]
 gi|95133337|gb|EAT15002.1| ribosomal protein S20 [Desulfuromonas acetoxidans DSM 684]
          Length = 87

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 2/82 (2%)

Query: 1  MANKDSA-KKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59
          MAN  SA K+  + I RR   N   RS++R+ +++   A+     + AT A  +A   I 
Sbjct: 1  MANHKSALKRNKQSIVRRDR-NTQARSTMRTMVKNVRLAVAEQNKDAATAALTQAVPYID 59

Query: 60 KAKSKGIFHGNAASRKVSRLSK 81
          K  ++GI H   ASRK+SRL+K
Sbjct: 60 KMATRGIIHKATASRKISRLTK 81


>gi|183219933|ref|YP_001837929.1| 30S ribosomal protein S20 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189910057|ref|YP_001961612.1| 30S ribosomal protein S20 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|226736514|sp|B0SBL3|RS20_LEPBA RecName: Full=30S ribosomal protein S20
 gi|226736515|sp|B0SJ57|RS20_LEPBP RecName: Full=30S ribosomal protein S20
 gi|167774733|gb|ABZ93034.1| 30S Ribosomal protein S20 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167778355|gb|ABZ96653.1| 30S ribosomal protein S20 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 91

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK IR+ ARR   N   R+ +R++ R   +AI  G   EA     K  S + +
Sbjct: 1  MANLKSSKKDIRRTARRKERNGEDRTELRTYARLLIKAIKSGDKTEALTVFSKLSSKLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A    + H   A RK SR++ R+  I
Sbjct: 61 AAKTKLIHKKNADRKKSRMALRINSI 86


>gi|110798940|ref|YP_696722.1| 30S ribosomal protein S20 [Clostridium perfringens ATCC 13124]
 gi|110802044|ref|YP_699323.1| 30S ribosomal protein S20 [Clostridium perfringens SM101]
 gi|168208744|ref|ZP_02634369.1| ribosomal protein S20 [Clostridium perfringens B str. ATCC 3626]
 gi|168212921|ref|ZP_02638546.1| ribosomal protein S20 [Clostridium perfringens CPE str. F4969]
 gi|168215669|ref|ZP_02641294.1| ribosomal protein S20 [Clostridium perfringens NCTC 8239]
 gi|169343659|ref|ZP_02864658.1| ribosomal protein S20 [Clostridium perfringens C str. JGS1495]
 gi|118573813|sp|Q0TNR8|RS20_CLOP1 RecName: Full=30S ribosomal protein S20
 gi|118573814|sp|Q0SRD4|RS20_CLOPS RecName: Full=30S ribosomal protein S20
 gi|110673587|gb|ABG82574.1| 30S ribosomal protein S20 [Clostridium perfringens ATCC 13124]
 gi|110682545|gb|ABG85915.1| 30S ribosomal protein S20 [Clostridium perfringens SM101]
 gi|169298219|gb|EDS80309.1| ribosomal protein S20 [Clostridium perfringens C str. JGS1495]
 gi|170713076|gb|EDT25258.1| ribosomal protein S20 [Clostridium perfringens B str. ATCC 3626]
 gi|170715619|gb|EDT27801.1| ribosomal protein S20 [Clostridium perfringens CPE str. F4969]
 gi|182382125|gb|EDT79604.1| ribosomal protein S20 [Clostridium perfringens NCTC 8239]
          Length = 87

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 18/95 (18%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV--- 57
          MAN  SAKK I+   ++TL NK  +S++++ ++         K E A EA  KAE+    
Sbjct: 1  MANIKSAKKRIKVTEKKTLRNKMIKSALKTAIK---------KFEVAVEANNKAEAATLY 51

Query: 58 ------IQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
                +  + SKG+ H N A+RK SRL+ +L  +
Sbjct: 52 VEAARALDMSASKGVVHKNMAARKKSRLAAKLNAM 86


>gi|312144020|ref|YP_003995466.1| ribosomal protein S20 [Halanaerobium sp. 'sapolanicus']
 gi|311904671|gb|ADQ15112.1| ribosomal protein S20 [Halanaerobium sp. 'sapolanicus']
          Length = 86

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SAKK ++   ++T  N+  +  +++ ++     +  G  E+A E  ++   VI KA S+ 
Sbjct: 6  SAKKRVKVTEKKTAQNREWKDKLKTAIKDFKNVVEAGNKEKAEEQLKETIKVIDKAVSRN 65

Query: 66 IFHGNAASRKVSRLSK 81
          I H N A+RK SRL+K
Sbjct: 66 IIHKNNAARKKSRLTK 81


>gi|157368941|ref|YP_001476930.1| 30S ribosomal protein S20 [Serratia proteamaculans 568]
 gi|167011215|sp|A8G9L2|RS20_SERP5 RecName: Full=30S ribosomal protein S20
 gi|157320705|gb|ABV39802.1| ribosomal protein S20 [Serratia proteamaculans 568]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S RS +R++++    AI  G  E A  A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASGRSMMRTYIKKVEAAIATGDKEAAQAAYAVMKPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  S LS R+  +
Sbjct: 61 KAAKGLIHKNKAARHKSNLSARINAL 86


>gi|225461526|ref|XP_002285149.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142967|emb|CBI20262.3| unnamed protein product [Vitis vinifera]
          Length = 183

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEA---------C 51
           M   DSA K +R+  +R + NK+R+S +R+ M+   E +   K +   +A          
Sbjct: 74  MRKADSAAKRVRQAEKRRIYNKARKSEIRTRMKKVLEELDGLKKKPDAQAEEVLPIEKLI 133

Query: 52  RKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
            +A SVI KA   G  H N  +R+ SRL++R K +
Sbjct: 134 AEAYSVIDKAVKVGTLHRNTGARRKSRLARRKKAV 168


>gi|189485373|ref|YP_001956314.1| 30S ribosomal protein S20 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
 gi|170287332|dbj|BAG13853.1| 30S ribosomal protein S20 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
          Length = 94

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%)

Query: 12 RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNA 71
          RK  +RT  NK+ +S +R+ ++   EA+    ++ A E      S   KA  K I H  A
Sbjct: 17 RKTKKRTERNKAIKSKIRTSIKKVEEAVKNNNVKVAQEHLSVVFSEWDKAAKKNIVHYKA 76

Query: 72 ASRKVSRLSKRLKGILT 88
          AS K +RLSK + GI+T
Sbjct: 77 ASNKKARLSKLVAGIIT 93


>gi|197303038|ref|ZP_03168086.1| hypothetical protein RUMLAC_01765 [Ruminococcus lactaris ATCC
          29176]
 gi|197297893|gb|EDY32445.1| hypothetical protein RUMLAC_01765 [Ruminococcus lactaris ATCC
          29176]
          Length = 90

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     +   NK+ +S V++ ++    A+     E A  A   A   I K
Sbjct: 4  LANIKSAKKRILVNETKAARNKAIKSKVKTAVKKVEAAVAAKDTEAAKAALHTAIVEISK 63

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG++H    SRK++RLSK +  I
Sbjct: 64 AGTKGVYHKKTVSRKIARLSKAVDAI 89


>gi|157960908|ref|YP_001500942.1| 30S ribosomal protein S20 [Shewanella pealeana ATCC 700345]
 gi|167623062|ref|YP_001673356.1| 30S ribosomal protein S20 [Shewanella halifaxensis HAW-EB4]
 gi|189044883|sp|B0TJA6|RS20_SHEHH RecName: Full=30S ribosomal protein S20
 gi|189044884|sp|A8H1H0|RS20_SHEPA RecName: Full=30S ribosomal protein S20
 gi|157845908|gb|ABV86407.1| ribosomal protein S20 [Shewanella pealeana ATCC 700345]
 gi|167353084|gb|ABZ75697.1| ribosomal protein S20 [Shewanella halifaxensis HAW-EB4]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SR S +R++++    AI  G    AT A   A+ ++ +
Sbjct: 1  MANSKSAKKRALQSEKRRQHNASRSSMLRTYVKKVIAAINAGDHATATAAFAVAQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
            +KG+ H N A+R  SRL+ ++K ++
Sbjct: 61 MATKGLIHKNKAARYKSRLNAKIKALV 87


>gi|332526341|ref|ZP_08402467.1| 30S ribosomal protein S20 [Rubrivivax benzoatilyticus JA2]
 gi|332110477|gb|EGJ10800.1| 30S ribosomal protein S20 [Rubrivivax benzoatilyticus JA2]
          Length = 100

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          N S RS  R+ +++  +A+  G    AT+  + A+SVI     KGIFH N A+R  SR
Sbjct: 31 NSSLRSRFRTVVKNVQKAVVAGDKTVATDTFKSAQSVIDSVADKGIFHKNKAARLKSR 88


>gi|125973554|ref|YP_001037464.1| ribosomal protein S20 [Clostridium thermocellum ATCC 27405]
 gi|125713779|gb|ABN52271.1| SSU ribosomal protein S20P [Clostridium thermocellum ATCC 27405]
          Length = 115

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           + N  SA K +R   ++TL N  R+S +++ ++   +AI   +   A EA + A   I K
Sbjct: 27  LPNIKSAIKRVRISKKKTLQNSMRKSILKTNIKKCKQAIANNE-PNAVEALKLAIKTIDK 85

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGIL 87
           A +K I H N A+RK S+L K L   L
Sbjct: 86  AAAKNIIHKNTAARKKSKLVKALNAAL 112


>gi|290960525|ref|YP_003491707.1| 30s ribosomal protein S20 [Streptomyces scabiei 87.22]
 gi|260650051|emb|CBG73167.1| 30s ribosomal protein S20 [Streptomyces scabiei 87.22]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G   +ATE  R A   + KA SKG+ H N A+ K S 
Sbjct: 17 LRNKAVKSSLKTAIRKAREAAAAGDTVKATEYQRAAARQLDKAVSKGVIHKNQAANKKSA 76

Query: 79 LSKRL 83
          L+ ++
Sbjct: 77 LASKV 81


>gi|120404866|ref|YP_954695.1| 30S ribosomal protein S20 [Mycobacterium vanbaalenii PYR-1]
 gi|166223955|sp|A1TBY9|RS20_MYCVP RecName: Full=30S ribosomal protein S20
 gi|119957684|gb|ABM14689.1| SSU ribosomal protein S20P [Mycobacterium vanbaalenii PYR-1]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K I    RR L NKS +SS+ + +R    A+  G  ++A E        + K
Sbjct: 1  MANIKSQQKRILTNERRRLRNKSVKSSLHTAVRGFRAAVEAGDKDKAGELLASTSRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S L+K L+ I
Sbjct: 61 AASKGVIHKNQAANRKSALAKALQKI 86


>gi|317493353|ref|ZP_07951775.1| ribosomal protein S20 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918746|gb|EFV40083.1| ribosomal protein S20 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 87

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFLKKVYAAIATGDKAAAQNAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  S L  ++  +
Sbjct: 61 QACKGLIHKNKAARHKSNLVAQINAM 86


>gi|258592113|emb|CBE68418.1| 30S ribosomal protein S20 [NC10 bacterium 'Dutch sediment']
          Length = 90

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 50/85 (58%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K +R+  +R L N++ +S++++ ++     I     + A +A  +A   I +A SKG
Sbjct: 6  SAQKHMRQSLKRRLRNRAAKSTLKTVIKKVRTGIEGSDRDAAEKAFLQAVPTIDRAASKG 65

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R  SRL++++  +  S+
Sbjct: 66 FIHKNAAARYKSRLARQVHALPQSS 90


>gi|217076242|ref|YP_002333958.1| ribosomal protein S20 [Thermosipho africanus TCF52B]
 gi|226695435|sp|B7IEV3|RS20_THEAB RecName: Full=30S ribosomal protein S20
 gi|217036095|gb|ACJ74617.1| ribosomal protein S20 [Thermosipho africanus TCF52B]
          Length = 92

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRK-AESVIQ 59
          M N  SAKK ++   R  LINK+ ++ +++ ++    A+  GK  E  E   K A+S I 
Sbjct: 1  MPNIKSAKKRVKVSERNRLINKAYKTRMKNSIKKVLLALQEGKSREEVEQLYKVAQSAID 60

Query: 60 KAKSKGIFHGNAASRKVSRL 79
          KA   G  H N ASR+ SRL
Sbjct: 61 KAAKIGAIHKNQASRRKSRL 80


>gi|34499202|ref|NP_903417.1| 30S ribosomal protein S20 [Chromobacterium violaceum ATCC 12472]
 gi|59798831|sp|Q7NRN3|RS20_CHRVO RecName: Full=30S ribosomal protein S20
 gi|34105053|gb|AAQ61409.1| 30S ribosomal protein S20 [Chromobacterium violaceum ATCC 12472]
          Length = 87

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R   ++   N S R++ R+ ++   +AI  G    A    + +E VI +
Sbjct: 1  MANSAQARKRARTALKQRAHNASLRTAFRTAVKKVLKAIEAGDKAAARVVFQASEKVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAQIKAM 86


>gi|56460239|ref|YP_155520.1| ribosomal protein S20 [Idiomarina loihiensis L2TR]
 gi|62510998|sp|Q5QZS3|RS20_IDILO RecName: Full=30S ribosomal protein S20
 gi|56179249|gb|AAV81971.1| Ribosomal protein S20 [Idiomarina loihiensis L2TR]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R++++  N AI     E A  A +    ++ +
Sbjct: 1  MANIKSAKKRAIQAEKNRRHNASRRSMMRTYLKRVNAAIETKDKEAANTAMKDVAPMLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+   N A+R  SRL+ ++K +
Sbjct: 61 YATKGLISKNKAARHKSRLNAKIKAL 86


>gi|325847820|ref|ZP_08170042.1| ribosomal protein S20 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325480838|gb|EGC83891.1| ribosomal protein S20 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I    ++T  NKS +S ++++++   +AI     E+A E  +  +  ++K
Sbjct: 1  MANIKSAIKRIDVTRKQTARNKSVKSEIKTYVKKFEQAIENKDSEKANELFKTVDKKVKK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +K I H N ASR  SRL+K+L  +
Sbjct: 61 AAAKNIIHKNQASRTSSRLAKKLNSL 86


>gi|302519010|ref|ZP_07271352.1| ribosomal protein S20 [Streptomyces sp. SPB78]
 gi|318061213|ref|ZP_07979934.1| 30S ribosomal protein S20 [Streptomyces sp. SA3_actG]
 gi|318076117|ref|ZP_07983449.1| 30S ribosomal protein S20 [Streptomyces sp. SA3_actF]
 gi|333027159|ref|ZP_08455223.1| putative 30S ribosomal protein S20 [Streptomyces sp. Tu6071]
 gi|302427905|gb|EFK99720.1| ribosomal protein S20 [Streptomyces sp. SPB78]
 gi|332747011|gb|EGJ77452.1| putative 30S ribosomal protein S20 [Streptomyces sp. Tu6071]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +SS+++ +R A EA   G +E+A E  R A   + KA S G+ H N A+ K S 
Sbjct: 19 LRNKAVKSSLKTAVRKAREAAAAGDVEKAQELTRVATRKLDKAVSSGVIHKNQAANKKSA 78

Query: 79 LS 80
          L+
Sbjct: 79 LA 80


>gi|297183898|gb|ADI20020.1| hypothetical protein [uncultured gamma proteobacterium
          EB000_65A11]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 48/89 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+   R   N S+RS++R+ ++ A  A+  G    A  A + A  V+ +
Sbjct: 1  MANTPQAKKRARQSEVRRKHNASQRSAMRTVIKKAIAAVEGGDHSAAQAAYQAAVPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A + GI H N A+R  SRL+  +K +  S
Sbjct: 61 AVTHGIIHKNKAARHKSRLNNHVKALAAS 89


>gi|221194369|ref|ZP_03567426.1| ribosomal protein S20 [Atopobium rimae ATCC 49626]
 gi|221185273|gb|EEE17663.1| ribosomal protein S20 [Atopobium rimae ATCC 49626]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +    NK+ RS +++ ++H   A+  G+ + A  A  KA  ++ K
Sbjct: 1  MANIKSQKKRILTAEKARQRNKAVRSELKTAVKHVRAAVEAGEKDAAQLAANKAGRLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKGI H N A+++ S + K
Sbjct: 61 AASKGIIHKNQAAKRKSGVQK 81


>gi|307719534|ref|YP_003875066.1| 30S ribosomal protein S20 [Spirochaeta thermophila DSM 6192]
 gi|306533259|gb|ADN02793.1| 30S ribosomal protein S20 [Spirochaeta thermophila DSM 6192]
          Length = 88

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA K SA K  R+  +R L NK+ +S +R+ ++    A++ G  E+A    R A   +  
Sbjct: 1  MATK-SALKRHRQSVKRYLRNKAAKSRIRTEVKKFLAAVSEGDKEKAEAQLRVAVKYLDT 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+RK SRL K+L  +
Sbjct: 60 YARKGIIHPNTAARKKSRLYKKLNAM 85


>gi|300690575|ref|YP_003751570.1| 30S ribosomal subunit protein S20 [Ralstonia solanacearum PSI07]
 gi|299077635|emb|CBJ50271.1| 30S ribosomal subunit protein S20 [Ralstonia solanacearum PSI07]
          Length = 88

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   +   N + RS +R+ ++   +AI+ G    A E  +KA+S I  
Sbjct: 1  MANTAQARKRARQAVAQNAHNSALRSRLRTAVKAVRKAISGGDKAAAAEVFKKAQSTIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARAKSRLSAAIKAM 86


>gi|240170818|ref|ZP_04749477.1| 30S ribosomal protein S20 [Mycobacterium kansasii ATCC 12478]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  R   R  L NKS +SS+R+ +R   EA   G  E+A E        + K
Sbjct: 1  MANIKSQQKRNRTNERARLRNKSVKSSLRTAVRAFREAAHAGDKEKAAELLVSTNRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ K S L++ L
Sbjct: 61 AASKGVIHKNQAANKKSALARTL 83


>gi|254819867|ref|ZP_05224868.1| 30S ribosomal protein S20 [Mycobacterium intracellulare ATCC
          13950]
          Length = 86

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  +   R  L NKS +SS+R+ +R   EA + G  E+A E        + K
Sbjct: 1  MANIKSQQKRNKTNERARLRNKSVKSSLRTAVRAFREATSAGDKEKAAELLVSTNRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ K S L++ L
Sbjct: 61 AASKGVIHKNQAANKKSALAQAL 83


>gi|323141879|ref|ZP_08076740.1| ribosomal protein S20 [Phascolarctobacterium sp. YIT 12067]
 gi|322413626|gb|EFY04484.1| ribosomal protein S20 [Phascolarctobacterium sp. YIT 12067]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N   ++S+R+  R        G  E+A      A  ++ K
Sbjct: 1  MPNIKSSIRSVKTDAERRAKNAPIKASLRNASRKVEALTKTGAKEDAQATMATASGLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H NAA+RK SRL+KR+  +
Sbjct: 61 AARKGIIHKNAAARKKSRLAKRINAM 86


>gi|297584661|ref|YP_003700441.1| 30S ribosomal protein S20 [Bacillus selenitireducens MLS10]
 gi|297143118|gb|ADH99875.1| ribosomal protein S20 [Bacillus selenitireducens MLS10]
          Length = 88

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +    +R   N S +S +RS ++  N  +    +E A  A   A   I K
Sbjct: 1  MANIKSAKKRVLTNEKRRAQNASFKSDLRSSVKVFNTKVEQKDVEGAKAAFTTAVKKIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A ++G++H N A+R+ S L +++ G+
Sbjct: 61 AVNRGVYHKNKAARQKSALQQKMNGL 86


>gi|323490047|ref|ZP_08095268.1| ribosomal protein S20 [Planococcus donghaensis MPA1U2]
 gi|323396343|gb|EGA89168.1| ribosomal protein S20 [Planococcus donghaensis MPA1U2]
          Length = 83

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +R    +   N   +S++RS ++ A  A+T  K + A +  + A   ++K
Sbjct: 1  MPNIKSAIKRVRTNDTKNAQNSHVKSAMRSSIKKAETALT-NKDDNANDTVKVAIQQVEK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKR 82
          A SKG+ H N A+RK SRL K+
Sbjct: 60 AASKGLIHKNTAARKKSRLMKQ 81


>gi|257452683|ref|ZP_05617982.1| SSU ribosomal protein S20P [Fusobacterium sp. 3_1_5R]
 gi|257466544|ref|ZP_05630855.1| SSU ribosomal protein S20P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|315917699|ref|ZP_07913939.1| SSU ribosomal protein S20P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|317059223|ref|ZP_07923708.1| SSU ribosomal protein S20P [Fusobacterium sp. 3_1_5R]
 gi|313684899|gb|EFS21734.1| SSU ribosomal protein S20P [Fusobacterium sp. 3_1_5R]
 gi|313691574|gb|EFS28409.1| SSU ribosomal protein S20P [Fusobacterium gonidiaformans ATCC
          25563]
          Length = 86

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 8/90 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV--- 57
          MAN  SAKK +  +A R   N+ R  +V++ ++  N+ +     ++  EA + A SV   
Sbjct: 1  MANSKSAKKRV-AVAER---NRERNQAVKTRVKTMNKKVVVAVQDQDAEAAKNALSVAYK 56

Query: 58 -IQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           + KA SKGI   N ASRK SRL+ ++  +
Sbjct: 57 ELDKAVSKGIMKKNTASRKKSRLAAKVNAL 86


>gi|238028452|ref|YP_002912683.1| 30S ribosomal protein S20 [Burkholderia glumae BGR1]
 gi|237877646|gb|ACR29979.1| 30S ribosomal protein S20 [Burkholderia glumae BGR1]
          Length = 91

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKSVRKAIDAGDQAKAAELYKAATKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRLS  +KG+  +A
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAIKGLQAAA 90


>gi|78779964|ref|YP_398076.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9312]
 gi|115305698|sp|Q318Q5|RS20_PROM9 RecName: Full=30S ribosomal protein S20
 gi|78713463|gb|ABB50640.1| SSU ribosomal protein S20P [Prochlorococcus marinus str. MIT
          9312]
          Length = 97

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SAKK I+   R  LINKS +S+VR+  +   E     K +   E       +  K
Sbjct: 1  MANNKSAKKRIKIAERNRLINKSYKSTVRTLTKKTLENCEKYKKDPNDENKDLVKTSLNK 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A S+I KA  K + H N  + + S+++  +K  L +
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANRKSKINNLVKTTLAT 96


>gi|258405805|ref|YP_003198547.1| 30S ribosomal protein S20 [Desulfohalobium retbaense DSM 5692]
 gi|257798032|gb|ACV68969.1| ribosomal protein S20 [Desulfohalobium retbaense DSM 5692]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 50/86 (58%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++   R   N++ ++ V++ ++    A+  G   +A EA ++A SV+ +
Sbjct: 1  MANHRSALKRHKQSLIRRDRNRAVKTRVKNALKTVYSAVENGDKGQAEEALKQASSVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +K + H   ASR +SRL+K++  +
Sbjct: 61 AATKRVIHWRNASRHISRLTKKVNAL 86


>gi|171057360|ref|YP_001789709.1| 30S ribosomal protein S20 [Leptothrix cholodnii SP-6]
 gi|170774805|gb|ACB32944.1| ribosomal protein S20 [Leptothrix cholodnii SP-6]
          Length = 100

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          S +K  R+  +    N + RS  R+ ++   +A+  G   +A++  + A+SVI     KG
Sbjct: 16 SGRKRARQDVKLNAANTALRSKFRTAVKGVLKAVATGDKAKASDTFKSAQSVIDSIADKG 75

Query: 66 IFHGNAASRKVSRLS 80
          IFH N ASR  SRLS
Sbjct: 76 IFHKNKASRLKSRLS 90


>gi|304557988|gb|ADM40652.1| SSU ribosomal protein [Edwardsiella tarda FL6-60]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R+F++    AI  G    A  A    + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKAAAQAAYNDMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  + L+ ++  +
Sbjct: 61 QANKGLIHKNKAARHKANLTAQINAM 86


>gi|223042012|ref|ZP_03612193.1| 30S ribosomal protein S20 [Actinobacillus minor 202]
 gi|240948166|ref|ZP_04752569.1| 30S ribosomal protein S20 [Actinobacillus minor NM305]
 gi|223017174|gb|EEF15605.1| 30S ribosomal protein S20 [Actinobacillus minor 202]
 gi|240297519|gb|EER48026.1| 30S ribosomal protein S20 [Actinobacillus minor NM305]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R+F++    A+  G    +  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTFIKKVYAAVATGDKAASQAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKAL 86


>gi|182418383|ref|ZP_02949678.1| ribosomal protein S20 [Clostridium butyricum 5521]
 gi|237666312|ref|ZP_04526297.1| ribosomal protein S20 [Clostridium butyricum E4 str. BoNT E
          BL5262]
 gi|182377765|gb|EDT75309.1| ribosomal protein S20 [Clostridium butyricum 5521]
 gi|237657511|gb|EEP55066.1| ribosomal protein S20 [Clostridium butyricum E4 str. BoNT E
          BL5262]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+    +TL N+  +S++++ ++    A+     EEA          +  
Sbjct: 1  MANIKSAKKRIKVTEVKTLKNRMIKSALKTAIKKFEAAVEAKNTEEAKALYTSVVKSLDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+RK SRL+ +L  +
Sbjct: 61 ATSKGVVHKNMAARKKSRLAAKLNAM 86


>gi|116787526|gb|ABK24542.1| unknown [Picea sitchensis]
          Length = 178

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 4   KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACR----------- 52
            DSA K  R+  +R + NKS +S +++ MR   EA+  GK+++AT               
Sbjct: 74  PDSAAKRARQAEKRRIYNKSHKSEIKTRMRKVFEAL--GKLKKATSPSPEDLIPIEKLIA 131

Query: 53  KAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           +A S I KA   G  H N    + SRLS+R K +
Sbjct: 132 EAYSSIDKAVKVGTLHRNTGGHRKSRLSRRKKAV 165


>gi|296269128|ref|YP_003651760.1| 30S ribosomal protein S20 [Thermobispora bispora DSM 43833]
 gi|296091915|gb|ADG87867.1| ribosomal protein S20 [Thermobispora bispora DSM 43833]
          Length = 95

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +R L NK+ +SS+++ +R   EA   G +EEA    R A   + K
Sbjct: 1  MANIKSQIKRNRQNEKRRLRNKAVKSSLKTAIRKFREAADQGNVEEAIVLLRAACRQLDK 60

Query: 61 AKSKGIFHGN-AASRK 75
          A SKG+ H N AA+RK
Sbjct: 61 AVSKGVIHKNQAANRK 76


>gi|218885396|ref|YP_002434717.1| 30S ribosomal protein S20 [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|226736484|sp|B8DPG2|RS20_DESVM RecName: Full=30S ribosomal protein S20
 gi|218756350|gb|ACL07249.1| ribosomal protein S20 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 87

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++  +R   N++ ++ +++ ++    A+     + A +A   A SV+ K
Sbjct: 1  MANHKSAIKRHKQSQKRAARNRAAKTRIKNVVKAVRAAVLQKDKDTAAQALTAAMSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A  KG+ H   A+RK+SRL+K
Sbjct: 61 AAGKGVIHWKKAARKISRLTK 81


>gi|89101074|ref|ZP_01173913.1| 30S ribosomal protein S20 [Bacillus sp. NRRL B-14911]
 gi|89084217|gb|EAR63379.1| 30S ribosomal protein S20 [Bacillus sp. NRRL B-14911]
          Length = 88

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    R   N + +SS+R+ ++ A  AI       A  A   A S + K
Sbjct: 1  MPNIKSAIKRVKTSEARNAQNVTVKSSMRTAVKKAEAAIVNEDTAAAKTAYANAVSQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAA+RK SRL+K+L  +
Sbjct: 61 AAAKGLIHKNAAARKQSRLAKKLNSL 86


>gi|15676374|ref|NP_273510.1| 30S ribosomal protein S20 [Neisseria meningitidis MC58]
 gi|59801831|ref|YP_208543.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae FA 1090]
 gi|121635395|ref|YP_975640.1| 30S ribosomal protein S20 [Neisseria meningitidis FAM18]
 gi|161870610|ref|YP_001599783.1| 30S ribosomal protein S20 [Neisseria meningitidis 053442]
 gi|194099296|ref|YP_002002390.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae NCCP11945]
 gi|218768773|ref|YP_002343285.1| 30S ribosomal protein S20 [Neisseria meningitidis Z2491]
 gi|225076012|ref|ZP_03719211.1| hypothetical protein NEIFLAOT_01039 [Neisseria flavescens
          NRL30031/H210]
 gi|239999561|ref|ZP_04719485.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae 35/02]
 gi|240014737|ref|ZP_04721650.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae DGI18]
 gi|240017185|ref|ZP_04723725.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae FA6140]
 gi|240081176|ref|ZP_04725719.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae FA19]
 gi|240113389|ref|ZP_04727879.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae MS11]
 gi|240116263|ref|ZP_04730325.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID18]
 gi|240118549|ref|ZP_04732611.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID1]
 gi|240121260|ref|ZP_04734222.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID24-1]
 gi|240124095|ref|ZP_04737051.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID332]
 gi|240126288|ref|ZP_04739174.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae SK-92-679]
 gi|240128760|ref|ZP_04741421.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae SK-93-1035]
 gi|241760777|ref|ZP_04758868.1| ribosomal protein S20 [Neisseria flavescens SK114]
 gi|254494278|ref|ZP_05107449.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae 1291]
 gi|254805509|ref|YP_003083730.1| 30S ribosomal protein S20 [Neisseria meningitidis alpha14]
 gi|260439922|ref|ZP_05793738.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae DGI2]
 gi|261366002|ref|ZP_05978885.1| ribosomal protein S20 [Neisseria mucosa ATCC 25996]
 gi|261379278|ref|ZP_05983851.1| ribosomal protein S20 [Neisseria subflava NJ9703]
 gi|261401385|ref|ZP_05987510.1| ribosomal protein S20 [Neisseria lactamica ATCC 23970]
 gi|268595373|ref|ZP_06129540.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae 35/02]
 gi|268597288|ref|ZP_06131455.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae FA19]
 gi|268599462|ref|ZP_06133629.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae MS11]
 gi|268601928|ref|ZP_06136095.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID18]
 gi|268604259|ref|ZP_06138426.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID1]
 gi|268682718|ref|ZP_06149580.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID332]
 gi|268684872|ref|ZP_06151734.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae SK-92-679]
 gi|268687145|ref|ZP_06154007.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae SK-93-1035]
 gi|291043199|ref|ZP_06568922.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae DGI2]
 gi|293398529|ref|ZP_06642707.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae F62]
 gi|304386752|ref|ZP_07369020.1| 30S ribosomal protein S20 [Neisseria meningitidis ATCC 13091]
 gi|313667846|ref|YP_004048130.1| 30S ribosomal protein S20 [Neisseria lactamica ST-640]
 gi|319639102|ref|ZP_07993859.1| 30S ribosomal protein S20 [Neisseria mucosa C102]
 gi|54039472|sp|P66508|RS20_NEIMB RecName: Full=30S ribosomal protein S20
 gi|54042164|sp|P66507|RS20_NEIMA RecName: Full=30S ribosomal protein S20
 gi|75432417|sp|Q5F6Q6|RS20_NEIG1 RecName: Full=30S ribosomal protein S20
 gi|166223956|sp|A1KVG4|RS20_NEIMF RecName: Full=30S ribosomal protein S20
 gi|189044872|sp|A9M260|RS20_NEIM0 RecName: Full=30S ribosomal protein S20
 gi|226736528|sp|B4RPA5|RS20_NEIG2 RecName: Full=30S ribosomal protein S20
 gi|7225690|gb|AAF40900.1| 30S ribosomal protein S20 [Neisseria meningitidis MC58]
 gi|59718726|gb|AAW90131.1| putative ribosomal protein S20 [Neisseria gonorrhoeae FA 1090]
 gi|120867101|emb|CAM10868.1| 30S ribosomal protein S20 [Neisseria meningitidis FAM18]
 gi|121052781|emb|CAM09127.1| 30S ribosomal protein S20 [Neisseria meningitidis Z2491]
 gi|161596163|gb|ABX73823.1| 30S ribosomal protein S20 [Neisseria meningitidis 053442]
 gi|193934586|gb|ACF30410.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae NCCP11945]
 gi|224952727|gb|EEG33936.1| hypothetical protein NEIFLAOT_01039 [Neisseria flavescens
          NRL30031/H210]
 gi|226513318|gb|EEH62663.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae 1291]
 gi|241318674|gb|EER55226.1| ribosomal protein S20 [Neisseria flavescens SK114]
 gi|254669051|emb|CBA07528.1| 30S ribosomal protein S20 [Neisseria meningitidis alpha14]
 gi|254670612|emb|CBA06583.1| 30S ribosomal protein S20 [Neisseria meningitidis alpha153]
 gi|254672559|emb|CBA06185.1| 30S ribosomal protein S20 [Neisseria meningitidis alpha275]
 gi|261391976|emb|CAX49440.1| 30S ribosomal protein S20 [Neisseria meningitidis 8013]
 gi|268548762|gb|EEZ44180.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae 35/02]
 gi|268551076|gb|EEZ46095.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae FA19]
 gi|268583593|gb|EEZ48269.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae MS11]
 gi|268586059|gb|EEZ50735.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID18]
 gi|268588390|gb|EEZ53066.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID1]
 gi|268623002|gb|EEZ55402.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae PID332]
 gi|268625156|gb|EEZ57556.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae SK-92-679]
 gi|268627429|gb|EEZ59829.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae SK-93-1035]
 gi|269208595|gb|EEZ75050.1| ribosomal protein S20 [Neisseria lactamica ATCC 23970]
 gi|284797712|gb|EFC53059.1| ribosomal protein S20 [Neisseria subflava NJ9703]
 gi|288565408|gb|EFC86968.1| ribosomal protein S20 [Neisseria mucosa ATCC 25996]
 gi|291012805|gb|EFE04788.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae DGI2]
 gi|291611000|gb|EFF40097.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae F62]
 gi|304339152|gb|EFM05238.1| 30S ribosomal protein S20 [Neisseria meningitidis ATCC 13091]
 gi|308388664|gb|ADO30984.1| 30S ribosomal protein S20 [Neisseria meningitidis alpha710]
 gi|313005308|emb|CBN86741.1| 30S ribosomal protein S20 [Neisseria lactamica 020-06]
 gi|316984740|gb|EFV63699.1| ribosomal protein S20 [Neisseria meningitidis H44/76]
 gi|317164810|gb|ADV08351.1| 30S ribosomal protein S20 [Neisseria gonorrhoeae TCDC-NG08107]
 gi|317399680|gb|EFV80344.1| 30S ribosomal protein S20 [Neisseria mucosa C102]
 gi|319411013|emb|CBY91411.1| 30S ribosomal protein S20 [Neisseria meningitidis WUE 2594]
 gi|325128775|gb|EGC51637.1| ribosomal protein S20 [Neisseria meningitidis N1568]
 gi|325132851|gb|EGC55530.1| ribosomal protein S20 [Neisseria meningitidis M6190]
 gi|325134828|gb|EGC57464.1| ribosomal protein S20 [Neisseria meningitidis M13399]
 gi|325136849|gb|EGC59447.1| ribosomal protein S20 [Neisseria meningitidis M0579]
 gi|325138831|gb|EGC61382.1| ribosomal protein S20 [Neisseria meningitidis ES14902]
 gi|325145000|gb|EGC67283.1| ribosomal protein S20 [Neisseria meningitidis M01-240013]
 gi|325198855|gb|ADY94311.1| ribosomal protein S20 [Neisseria meningitidis G2136]
 gi|325199648|gb|ADY95103.1| ribosomal protein S20 [Neisseria meningitidis H44/76]
 gi|325202730|gb|ADY98184.1| ribosomal protein S20 [Neisseria meningitidis M01-240149]
 gi|325203567|gb|ADY99020.1| ribosomal protein S20 [Neisseria meningitidis M01-240355]
 gi|325205528|gb|ADZ00981.1| ribosomal protein S20 [Neisseria meningitidis M04-240196]
 gi|325208726|gb|ADZ04178.1| ribosomal protein S20 [Neisseria meningitidis NZ-05/33]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S R++ R+ ++   +A+  G    A    +++  VI +
Sbjct: 1  MANSAQARKRARQSVKQRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQAVYQESVKVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAKVKAL 86


>gi|170078652|ref|YP_001735290.1| 30S ribosomal protein S20 [Synechococcus sp. PCC 7002]
 gi|226695434|sp|B1XHW6|RS20_SYNP2 RecName: Full=30S ribosomal protein S20
 gi|169886321|gb|ACB00035.1| 30S ribosomal protein S20 [Synechococcus sp. PCC 7002]
          Length = 99

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-------TFGKIEEATEACRK 53
          MAN  SA K I+   R  L NKS +S+V++  +   +AI       +     EA +    
Sbjct: 1  MANIKSAIKRIQTAERNRLRNKSYKSAVKTLTKKCLQAIEQYAAAPSADAQAEAQKYLSA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
            S I KA  +G++H N A+RK +RL+K  K
Sbjct: 61 TYSKIDKAVKRGVYHHNTAARKKARLAKEFK 91


>gi|109899486|ref|YP_662741.1| ribosomal protein S20 [Pseudoalteromonas atlantica T6c]
 gi|332305529|ref|YP_004433380.1| ribosomal protein S20 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|122971691|sp|Q15R01|RS20_PSEA6 RecName: Full=30S ribosomal protein S20
 gi|109701767|gb|ABG41687.1| SSU ribosomal protein S20P [Pseudoalteromonas atlantica T6c]
 gi|332172858|gb|AEE22112.1| ribosomal protein S20 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  RR   N SRRS  R+ ++    AI  G    A  A   A  +I +
Sbjct: 1  MANIKSAKKRALQSERRRQHNASRRSMTRTSLKKVLAAIASGDKASAQAAFAAATPLIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRLS ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLSAQIKAL 86


>gi|300715260|ref|YP_003740063.1| 30S ribosomal protein S20 [Erwinia billingiae Eb661]
 gi|299061096|emb|CAX58203.1| 30S ribosomal protein S20 [Erwinia billingiae Eb661]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F++    A+  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASRRSMLRTFIKKVYAAVALGDKAAAQNAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLAAQI 83


>gi|332686733|ref|YP_004456507.1| 30S ribosomal protein S20p [Melissococcus plutonius ATCC 35311]
 gi|332370742|dbj|BAK21698.1| SSU ribosomal protein S20p [Melissococcus plutonius ATCC 35311]
          Length = 84

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K +RK       N S+++S+R+ ++   EA+T G         ++A   I  
Sbjct: 1  MPNIESAIKRVRKNENANEQNSSQKNSMRTAIKKFEEAVTAG-ANNVDVLHKEAIKAIDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A++KG+ H N AS   SRLSK+L
Sbjct: 60 AETKGLIHKNKASHDKSRLSKKL 82


>gi|332289395|ref|YP_004420247.1| 30S ribosomal protein S20 [Gallibacterium anatis UMN179]
 gi|330432291|gb|AEC17350.1| 30S ribosomal protein S20 [Gallibacterium anatis UMN179]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++++    A+  G    A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAIQSEKRRQHNASRRSMMRTYIKKVYAAVAAGDKAVAEAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+LS ++K +
Sbjct: 61 MASKGLIHKNKAANHKSKLSAQIKKL 86


>gi|257063739|ref|YP_003143411.1| ribosomal protein S20 [Slackia heliotrinireducens DSM 20476]
 gi|256791392|gb|ACV22062.1| ribosomal protein S20 [Slackia heliotrinireducens DSM 20476]
          Length = 162

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  + NK+ +S +++ +R   EA+  G   EA  A +KA  ++ K
Sbjct: 1  MANIKSQKKRILTAEKARMRNKAIKSELKTAVRAVREAVAAGNGVEAYVAAQKACRLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A +KG+ H N A+ + S + K    I+T 
Sbjct: 61 AATKGVIHKNQAANRKSGVMKLANTIVTP 89


>gi|78184180|ref|YP_376615.1| 30S ribosomal protein S20 [Synechococcus sp. CC9902]
 gi|118574565|sp|Q3AZA6|RS20_SYNS9 RecName: Full=30S ribosomal protein S20
 gi|78168474|gb|ABB25571.1| SSU ribosomal protein S20P [Synechococcus sp. CC9902]
          Length = 98

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEA----TEACRK 53
          MAN +SAKK I    R  L N++ +SS+R+ M+    A +A      EEA      + R+
Sbjct: 1  MANNNSAKKRIEIAERNRLRNRTYKSSMRTLMKRCFSACDAYGSAPGEEAKASVQASLRE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A S I KA   G+ H N  + + SRLS  ++ +L
Sbjct: 61 AFSKIDKAVKVGVLHRNNGANQKSRLSSAVRKVL 94


>gi|87307986|ref|ZP_01090128.1| probable 30S ribosomal protein S20 [Blastopirellula marina DSM
          3645]
 gi|87289068|gb|EAQ80960.1| probable 30S ribosomal protein S20 [Blastopirellula marina DSM
          3645]
          Length = 91

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK +R+   R   NK+ +S++R+ +R    AIT G         + A   + K
Sbjct: 1  MPNTKSAKKRLRQNEVRRARNKAVKSALRNQVRKVRTAITTGDAAVIDTEMKGAVKRLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A + GI H NAA+R  SRL+
Sbjct: 61 AAAAGIIHANAAARLKSRLN 80


>gi|238021856|ref|ZP_04602282.1| hypothetical protein GCWU000324_01760 [Kingella oralis ATCC
          51147]
 gi|237866470|gb|EEP67512.1| hypothetical protein GCWU000324_01760 [Kingella oralis ATCC
          51147]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 8/90 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANE----AITFGKIEEATEACRKAES 56
          MAN   A    RK AR++L N++  +S+R+  R A +    A+  G    A    R++  
Sbjct: 1  MANSAQA----RKRARQSLKNRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQAVYRESTK 56

Query: 57 VIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          V+ +   KG+FH N A+R  SRLS ++K +
Sbjct: 57 VLDRIADKGVFHKNKAARHKSRLSAKVKAM 86


>gi|152976753|ref|YP_001376270.1| 30S ribosomal protein S20 [Bacillus cereus subsp. cytotoxis NVH
          391-98]
 gi|189044848|sp|A7GT17|RS20_BACCN RecName: Full=30S ribosomal protein S20
 gi|152025505|gb|ABS23275.1| ribosomal protein S20 [Bacillus cytotoxicus NVH 391-98]
          Length = 85

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +    R   N S +S +R+ ++     ++   +E A EA + A   + K
Sbjct: 1  MANIKSAIKRAKLSEERRAHNASIKSDMRTAVKTVEALVSNNDLENAKEAFKTASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A  KG+ H NAA+R+ SRL+K++
Sbjct: 61 AARKGLIHQNAAARQKSRLAKKV 83


>gi|113460562|ref|YP_718626.1| 30S ribosomal protein S20 [Haemophilus somnus 129PT]
 gi|170718909|ref|YP_001784079.1| 30S ribosomal protein S20 [Haemophilus somnus 2336]
 gi|123031222|sp|Q0I2D7|RS20_HAES1 RecName: Full=30S ribosomal protein S20
 gi|189044867|sp|B0USI0|RS20_HAES2 RecName: Full=30S ribosomal protein S20
 gi|112822605|gb|ABI24694.1| SSU ribosomal protein S20P [Haemophilus somnus 129PT]
 gi|168827038|gb|ACA32409.1| ribosomal protein S20 [Haemophilus somnus 2336]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R+F++    A+  G    A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTFIKKTYAAVATGDKAVAQAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|197336246|ref|YP_002155219.1| ribosomal protein S20 [Vibrio fischeri MJ11]
 gi|226695439|sp|B5FA57|RS20_VIBFM RecName: Full=30S ribosomal protein S20
 gi|197317736|gb|ACH67183.1| ribosomal protein S20 [Vibrio fischeri MJ11]
          Length = 86

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  RR   N SRRS +R++M+    AI  G  E AT A   A  ++ +
Sbjct: 1  MANSKSAKKRATQAERRRQHNASRRSMMRTYMKKTIAAIEAGDKEAATAALATATPLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  +R +  +K +
Sbjct: 61 MATKGLIHKNKAARHKARFTAAIKAL 86


>gi|85712272|ref|ZP_01043323.1| Ribosomal protein S20 [Idiomarina baltica OS145]
 gi|85693899|gb|EAQ31846.1| Ribosomal protein S20 [Idiomarina baltica OS145]
          Length = 86

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R++++  N AI     E A+ A +    ++ +
Sbjct: 1  MANIKSAKKRAIQAEKNRRHNASRRSMMRTYLKRVNAAIESKDKEAASSALQTVTPLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+   N A+R  SRL+ +++ +
Sbjct: 61 YATKGLISKNKAARHKSRLNAKIQAL 86


>gi|108804354|ref|YP_644291.1| 30S ribosomal protein S20P [Rubrobacter xylanophilus DSM 9941]
 gi|118573841|sp|Q1AVU9|RS20_RUBXD RecName: Full=30S ribosomal protein S20
 gi|108765597|gb|ABG04479.1| SSU ribosomal protein S20P [Rubrobacter xylanophilus DSM 9941]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N+S R+ +R+  +    A+  G +E A     +A+    KA  KGI H N ASRK+SR  
Sbjct: 18 NRSVRTRLRNLSKKFYRALDAGDLESARSVRDEAQKAYDKAAGKGIIHRNKASRKLSRFD 77

Query: 81 KRLKG 85
          + L G
Sbjct: 78 RALAG 82


>gi|94501199|ref|ZP_01307721.1| ribosomal protein S20 [Oceanobacter sp. RED65]
 gi|94426626|gb|EAT11612.1| ribosomal protein S20 [Oceanobacter sp. RED65]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   ++K  R+   R   N S RS VR++++    AI     ++A  A   A   + K
Sbjct: 1  MANSAGSRKRARQAVGRRAHNASLRSMVRTYIKKVRAAIDTKNYDDAQAALTVAIPYVDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
            +KGI H N A+R  SRL+
Sbjct: 61 MVTKGILHKNKAARIKSRLN 80


>gi|330818116|ref|YP_004361821.1| 30S ribosomal protein S20 [Burkholderia gladioli BSR3]
 gi|327370509|gb|AEA61865.1| 30S ribosomal protein S20 [Burkholderia gladioli BSR3]
          Length = 91

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDQAKAAELYKAATKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRLS  +KG+  +A
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAVKGLQAAA 90


>gi|227504497|ref|ZP_03934546.1| 30S ribosomal protein S20 [Corynebacterium striatum ATCC 6940]
 gi|227198914|gb|EEI78962.1| 30S ribosomal protein S20 [Corynebacterium striatum ATCC 6940]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 44/80 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +    NK+ RS+VR+ +R   E +T G  E A +  R A   + K
Sbjct: 1  MANIKSKKKRIITNEKARQRNKAVRSAVRTEIRKFRELVTAGDKEAAEKQLRVASRALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          + SKG+FH N A+ K S ++
Sbjct: 61 SVSKGVFHRNTAANKKSGMA 80


>gi|224824730|ref|ZP_03697837.1| ribosomal protein S20 [Lutiella nitroferrum 2002]
 gi|224603223|gb|EEG09399.1| ribosomal protein S20 [Lutiella nitroferrum 2002]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S R++ R+ ++   +A+  G    A +  + +  VI +
Sbjct: 1  MANSAQARKRARQALKQRAHNASLRTAFRTAVKKVIKAVEAGDKAAAKDVFQASVKVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAQIKAM 86


>gi|149928098|ref|ZP_01916345.1| 30S ribosomal protein S20 [Limnobacter sp. MED105]
 gi|149823184|gb|EDM82421.1| 30S ribosomal protein S20 [Limnobacter sp. MED105]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  ++ A+    N + RS++R+ ++    A+  G    A    R+  S++ +
Sbjct: 1  MANTAQARKRAKQAAKANAHNSAIRSAMRTAVKKVRAAVEAGDKAAAQAVYRETTSILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K + H N ASR  SRLS  +KG+
Sbjct: 61 VADKDLIHKNKASRNKSRLSALVKGM 86


>gi|92112611|ref|YP_572539.1| SSU ribosomal protein S20P [Chromohalobacter salexigens DSM 3043]
 gi|118573811|sp|Q1R0B8|RS20_CHRSD RecName: Full=30S ribosomal protein S20
 gi|91795701|gb|ABE57840.1| SSU ribosomal protein S20P [Chromohalobacter salexigens DSM 3043]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +R   N S+RS VR++++   +AI  G   +A    + A+ VI +
Sbjct: 1  MANTKQAQKRARQAEQRRQHNASQRSMVRTYIKRVIKAIQGGDHAQAMTEFKAAQPVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K       A+R  SRL+KR+K +
Sbjct: 61 IADKDAISKKKAARIKSRLNKRIKAL 86


>gi|323492571|ref|ZP_08097717.1| 30S ribosomal protein S20 [Vibrio brasiliensis LMG 20546]
 gi|323313173|gb|EGA66291.1| 30S ribosomal protein S20 [Vibrio brasiliensis LMG 20546]
          Length = 86

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G    ATEA      ++ +
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIEAGDKAAATEAFAAVTPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SR +  +K +
Sbjct: 61 MATKGLIHKNKAARHKSRFAAAIKAL 86


>gi|113476517|ref|YP_722578.1| 30S ribosomal protein S20 [Trichodesmium erythraeum IMS101]
 gi|110167565|gb|ABG52105.1| SSU ribosomal protein S20P [Trichodesmium erythraeum IMS101]
          Length = 112

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (50%), Gaps = 9/97 (9%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMR--------HANEAITFGKIEEATEACR 52
          MAN  SA K I+   R  L NKS +S+VR+ M+        +A+      KIE   +   
Sbjct: 1  MANIKSAIKRIQVAERNRLRNKSYKSAVRTLMKKYFTTVEKYASNPTDELKIE-VEQQMS 59

Query: 53 KAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          KA S I KA  +G+ H N  SRK +RL +  K  L S
Sbjct: 60 KAYSKIDKAVKRGVLHKNNGSRKKARLVRFYKRHLIS 96


>gi|75704128|gb|ABA23804.1| SSU ribosomal protein S20P [Anabaena variabilis ATCC 29413]
          Length = 109

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-------TFGKIEEATEACRK 53
           +AN  SA K  +   R  + NK+ +SSV++ M++   A+       T    +EA      
Sbjct: 13  VANNKSALKRAQIAERNRVRNKTYKSSVKTLMKNYLSAVQAYAANPTPESKQEAQTRLAA 72

Query: 54  AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
           A S I KA  +GI H N  +RK SRL+ +LK I  +A
Sbjct: 73  AYSRIDKAVKRGILHPNNGARKKSRLASKLKPIEQTA 109


>gi|255068289|ref|ZP_05320144.1| trigger factor [Neisseria sicca ATCC 29256]
 gi|255047481|gb|EET42945.1| trigger factor [Neisseria sicca ATCC 29256]
          Length = 159

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN   A+K  R+  ++   N S R++ R+ ++   +A+  G    A    +++  VI +
Sbjct: 73  MANSAQARKRARQSVKQRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQAVYQESVKVIDR 132

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
              KG+FH N A+R  SRLS ++K +
Sbjct: 133 IADKGVFHKNKAARHKSRLSAKVKAL 158


>gi|225016453|ref|ZP_03705645.1| hypothetical protein CLOSTMETH_00359 [Clostridium methylpentosum
          DSM 5476]
 gi|224950794|gb|EEG32003.1| hypothetical protein CLOSTMETH_00359 [Clostridium methylpentosum
          DSM 5476]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 23/96 (23%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHA-----------NEAITFGKIEEATE 49
          M N  SAKK +  I  +TL NK  +S++++ ++ A            +AI F  I++  +
Sbjct: 1  MPNIKSAKKRVNVIKTKTLRNKMIKSNLKTVIKTADAAVANNADNKQDAIKFA-IKKVDQ 59

Query: 50 ACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKG 85
          AC           +KGI+H N A+RK S+L K+L G
Sbjct: 60 AC-----------AKGIYHKNKAARKKSQLMKQLNG 84


>gi|323341653|ref|ZP_08081886.1| 30S ribosomal protein S20 [Erysipelothrix rhusiopathiae ATCC
          19414]
 gi|322464078|gb|EFY09271.1| 30S ribosomal protein S20 [Erysipelothrix rhusiopathiae ATCC
          19414]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NKS+RSS+++ +R  N AI  G  E+A     ++ S++ K+ +  I H N  +RK S LS
Sbjct: 21 NKSQRSSLKTSLRSFNSAIESGDKEKAEILFNQSNSLLDKSITSNIHHKNYVARKKSDLS 80

Query: 81 KRLKGI 86
           +L  +
Sbjct: 81 LKLNSL 86


>gi|255282387|ref|ZP_05346942.1| ribosomal protein S20 [Bryantella formatexigens DSM 14469]
 gi|255266971|gb|EET60176.1| ribosomal protein S20 [Bryantella formatexigens DSM 14469]
          Length = 99

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK I     + + NKS +S V++ ++    A+       A+EA   A SVI K
Sbjct: 14 LANIKSAKKRILVNRTKAMRNKSIKSGVKTAIKKVEAAVAAQDKAAASEALLSATSVIDK 73

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A  KG++H N A+RKVSRL+K
Sbjct: 74 AAKKGVYHKNNAARKVSRLAK 94


>gi|115305669|sp|Q3M5D2|RS20_ANAVT RecName: Full=30S ribosomal protein S20
          Length = 98

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 2  ANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE------ 55
          AN  SA K  +   R  + NK+ +SSV++ M++   A+         E+ ++A+      
Sbjct: 3  ANNKSALKRAQIAERNRVRNKTYKSSVKTLMKNYLSAVQAYAANPTPESKQEAQTRLAAA 62

Query: 56 -SVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
           S I KA  +GI H N  +RK SRL+ +LK I  +A
Sbjct: 63 YSRIDKAVKRGILHPNNGARKKSRLASKLKPIEQTA 98


>gi|291086714|ref|ZP_06344230.2| ribosomal protein S20 [Clostridium sp. M62/1]
 gi|291077408|gb|EFE14772.1| ribosomal protein S20 [Clostridium sp. M62/1]
          Length = 92

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 56 SVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          S I KA +KG++H N ASRKVSRLSK + G+
Sbjct: 61 SEIDKACTKGVYHKNTASRKVSRLSKAVNGM 91


>gi|261378391|ref|ZP_05982964.1| ribosomal protein S20 [Neisseria cinerea ATCC 14685]
 gi|269145163|gb|EEZ71581.1| ribosomal protein S20 [Neisseria cinerea ATCC 14685]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S R++ R+ ++   +A+  G    A    +++  +I +
Sbjct: 1  MANSAQARKRARQSVKQRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQAVYKESVKIIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAKVKAL 86


>gi|298490332|ref|YP_003720509.1| 30S ribosomal protein S20 ['Nostoc azollae' 0708]
 gi|298232250|gb|ADI63386.1| ribosomal protein S20 ['Nostoc azollae' 0708]
          Length = 116

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEATEACRK---- 53
           +AN  SA K  +   R  L NK+ +S+V++ M+    A E  T     E+ +A  +    
Sbjct: 23  VANTKSALKRAQIAERNRLRNKAYKSAVKTLMKKYFAAVEVYTANPTPESKQAVEERISE 82

Query: 54  AESVIQKAKSKGIFHGNAASRKVSRLSKRLKG 85
           A S I KA  +G+ H N  +RK SRL+ +LK 
Sbjct: 83  AYSKIDKAVKRGVLHPNTGARKKSRLAHKLKP 114


>gi|146329107|ref|YP_001209913.1| 30S ribosomal protein S20 [Dichelobacter nodosus VCS1703A]
 gi|166223933|sp|A5EXX2|RS20_DICNV RecName: Full=30S ribosomal protein S20
 gi|146232577|gb|ABQ13555.1| 30S ribosomal protein S20 [Dichelobacter nodosus VCS1703A]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A K IR+  +    N S+RS++R+ M+   +AI    I  A +    A S++ +
Sbjct: 1  MANTAQALKRIRQTNKARAQNASQRSTIRTVMKKFLKAIEAKDIATAEQEFSTAASLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A  K I H N ASR  SR+  + K ++
Sbjct: 61 AAQKHIIHKNKASRLKSRMHAKKKALV 87


>gi|293363398|ref|ZP_06610197.1| ribosomal protein S20 [Mycoplasma alligatoris A21JP2]
 gi|292552993|gb|EFF41745.1| ribosomal protein S20 [Mycoplasma alligatoris A21JP2]
          Length = 88

 Score = 40.0 bits (92), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  + I K+    + N + +S V+  +R A EA+     E+A E   KA S I  
Sbjct: 1  MANIKSKIRSIAKMEEARVRNNAIKSQVKKAIRKAREAV-LSNDEKANELVAKASSKIAW 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  KG+FH N  +RK SRL+
Sbjct: 60 AVQKGVFHPNKGARKQSRLA 79


>gi|300858992|ref|YP_003783975.1| 30S ribosomal protein S20 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|300686446|gb|ADK29368.1| 30S ribosomal protein S20 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|302206690|gb|ADL11032.1| 30S ribosomal protein S20 [Corynebacterium pseudotuberculosis
          C231]
 gi|302331243|gb|ADL21437.1| 30S ribosomal protein S20 [Corynebacterium pseudotuberculosis
          1002]
 gi|308276933|gb|ADO26832.1| 30S ribosomal protein S20 [Corynebacterium pseudotuberculosis
          I19]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK +    +  L NK+ RS+VR+ +R   EA+  G    A    R A   + K
Sbjct: 1  MANIKSQKKRVLTNEKARLRNKTIRSAVRTEIRKFREAVAAGDKTAAETQLRVASRALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          + +KG+FH N A+ K S ++  L
Sbjct: 61 SVTKGVFHRNNAANKKSNMAHAL 83


>gi|332974560|gb|EGK11480.1| trigger factor [Kingella kingae ATCC 23330]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 8/90 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANE----AITFGKIEEATEACRKAES 56
          MAN   A    RK AR++L N++  +S+R+  R A +    A+  G    A    R +  
Sbjct: 1  MANSAQA----RKRARQSLKNRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQATFRDSTK 56

Query: 57 VIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          V+ +   KG+FH N A+R  SRLS ++K +
Sbjct: 57 VLDRIADKGVFHKNKAARHKSRLSAKIKAM 86


>gi|229505700|ref|ZP_04395210.1| SSU ribosomal protein S20p [Vibrio cholerae BX 330286]
 gi|229508726|ref|ZP_04398219.1| SSU ribosomal protein S20p [Vibrio cholerae B33]
 gi|229512940|ref|ZP_04402407.1| SSU ribosomal protein S20p [Vibrio cholerae TMA 21]
 gi|229519524|ref|ZP_04408967.1| SSU ribosomal protein S20p [Vibrio cholerae RC9]
 gi|229519953|ref|ZP_04409383.1| SSU ribosomal protein S20p [Vibrio cholerae TM 11079-80]
 gi|229525331|ref|ZP_04414736.1| SSU ribosomal protein S20p [Vibrio cholerae bv. albensis VL426]
 gi|229530485|ref|ZP_04419873.1| SSU ribosomal protein S20p [Vibrio cholerae 12129(1)]
 gi|229608719|ref|YP_002879367.1| 30S ribosomal protein S20 [Vibrio cholerae MJ-1236]
 gi|229332258|gb|EEN97746.1| SSU ribosomal protein S20p [Vibrio cholerae 12129(1)]
 gi|229338912|gb|EEO03929.1| SSU ribosomal protein S20p [Vibrio cholerae bv. albensis VL426]
 gi|229343005|gb|EEO07993.1| SSU ribosomal protein S20p [Vibrio cholerae TM 11079-80]
 gi|229344213|gb|EEO09188.1| SSU ribosomal protein S20p [Vibrio cholerae RC9]
 gi|229350189|gb|EEO15142.1| SSU ribosomal protein S20p [Vibrio cholerae TMA 21]
 gi|229354250|gb|EEO19180.1| SSU ribosomal protein S20p [Vibrio cholerae B33]
 gi|229357923|gb|EEO22840.1| SSU ribosomal protein S20p [Vibrio cholerae BX 330286]
 gi|229371374|gb|ACQ61797.1| SSU ribosomal protein S20p [Vibrio cholerae MJ-1236]
          Length = 91

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A      ++ +
Sbjct: 6  LANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR 65

Query: 61 AKSKGIFHGNAASRKVSRL 79
            +KG+ H N A+R  SR 
Sbjct: 66 MATKGLIHKNKAARHKSRF 84


>gi|227495106|ref|ZP_03925422.1| ribosomal protein S20 [Actinomyces coleocanis DSM 15436]
 gi|226831558|gb|EEH63941.1| ribosomal protein S20 [Actinomyces coleocanis DSM 15436]
          Length = 86

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +R + NK+ +S +++F+R   EAI  G  E A  A R A   + K
Sbjct: 1  MANIKSQMKRIKTNEKRRIRNKAVKSELKTFVRRVREAIVAGDREAAEAALRLAGKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S+L++++
Sbjct: 61 AASKGVIHRNQAANRQSKLAQQI 83


>gi|118411130|ref|YP_874524.1| 30S ribosomal protein S20 [Thalassiosira pseudonana]
 gi|125987741|sp|A0T0R2|RR20_THAPS RecName: Full=30S ribosomal protein S20, chloroplastic
 gi|116739877|gb|ABK20747.1| 30S ribosomal protein S20 [Thalassiosira pseudonana]
          Length = 93

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 7/92 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SAKK I    R  L N+  +SSVR+  +     +   KI ++     K +     
Sbjct: 1  MANNKSAKKRILITKRNNLQNRFYKSSVRTLTKRFLSDLETYKISQSNTDKDKLQNGLSS 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRLSKRLKG 85
            S+I K   K ++H N A+RK S+L+  LK 
Sbjct: 61 IYSLIDKGYKKNVYHKNTAARKKSKLAALLKA 92


>gi|239993320|ref|ZP_04713844.1| ribosomal protein S20 [Alteromonas macleodii ATCC 27126]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS  R+ ++    AI  G  E A  A   A  V+ +
Sbjct: 1  MANIKSAKKRAIQAEKRRQHNASRRSMTRTSIKKVIAAIASGDKEAAQAALTAATPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLAAQIKAL 86


>gi|150021625|ref|YP_001306979.1| 30S ribosomal protein S20 [Thermosipho melanesiensis BI429]
 gi|166223997|sp|A6LNU3|RS20_THEM4 RecName: Full=30S ribosomal protein S20
 gi|149794146|gb|ABR31594.1| ribosomal protein S20 [Thermosipho melanesiensis BI429]
          Length = 91

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRK-AESVIQ 59
          M N  SAK+ ++   R  LINK+ ++ +++ ++    A++ GK +E  E   K A+S I 
Sbjct: 1  MPNIKSAKRRVKISERNRLINKAYKTRMKNSIKKVLLALSEGKTKEEVEQLYKIAQSAID 60

Query: 60 KAKSKGIFHGNAASRKVSRL 79
          KA   G  H N A+R+ SRL
Sbjct: 61 KAAKIGAVHKNEAARRKSRL 80


>gi|40063213|gb|AAR38050.1| ribosomal protein S20 [uncultured marine bacterium 562]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   + K  ++ A    +  ++RS VR+ ++     I      +A EA  +AE V+  
Sbjct: 1  MANSKQSLKRAKQNAETYKLRHAQRSMVRTAVKAVRAGIDENDSAKAKEALTRAEKVLDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          + SK + H NAA+R  SRLSK +K +
Sbjct: 61 SASKKVIHKNAAARTKSRLSKAVKAL 86


>gi|116071174|ref|ZP_01468443.1| 30S ribosomal protein S20 [Synechococcus sp. BL107]
 gi|116066579|gb|EAU72336.1| 30S ribosomal protein S20 [Synechococcus sp. BL107]
          Length = 98

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAIT-FGKI--EEA----TEACRK 53
          MAN +SAKK I    R  L N++ +SS+R+ M+    A   +G    EEA      + R+
Sbjct: 1  MANNNSAKKRIEIAERNRLRNRTYKSSMRTLMKRCFSACDAYGSTPGEEAKASVQASLRE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A S I KA   G+ H N  + + SRLS  ++ +L
Sbjct: 61 AFSKIDKAVKVGVLHRNNGANQKSRLSSAVRKVL 94


>gi|50955100|ref|YP_062388.1| 30S ribosomal protein S20 [Leifsonia xyli subsp. xyli str.
          CTCB07]
 gi|59798683|sp|Q6AEB3|RS20_LEIXX RecName: Full=30S ribosomal protein S20
 gi|50951582|gb|AAT89283.1| 30S ribosomal protein S20 [Leifsonia xyli subsp. xyli str.
          CTCB07]
          Length = 86

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S +++ +R   EA+  G  E+A+ A R A   + KA SKG+ H N A+ + S ++
Sbjct: 21 NKAVKSELKTAIRATREAVATGDKEKASSALRLASKKLDKAASKGVIHKNQAANRKSAIA 80

Query: 81 KRLKGI 86
          K++  +
Sbjct: 81 KQVAAL 86


>gi|332141930|ref|YP_004427668.1| 30S ribosomal subunit protein S20 [Alteromonas macleodii str.
          'Deep ecotype']
 gi|327551952|gb|AEA98670.1| 30S ribosomal subunit protein S20 [Alteromonas macleodii str.
          'Deep ecotype']
          Length = 87

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS  R+ ++    AI  G  E A  A   A  V+ +
Sbjct: 1  MANIKSAKKRAIQAEKRRQHNASRRSMTRTSIKKVIAAIASGDKEAAQAALSAATPVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 MATKGLIHKNKAARHKSRLAAQIKAL 86


>gi|295698740|ref|YP_003603395.1| ribosomal protein S20 [Candidatus Riesia pediculicola USDA]
 gi|291157261|gb|ADD79706.1| ribosomal protein S20 [Candidatus Riesia pediculicola USDA]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N  R+S +++F +     ++   IE+A     + +S++ +   K + H N ASRK SRLS
Sbjct: 18 NMRRKSMIKTFTKRVLSFLSNKDIEQAKYYFNRVQSILDRFSQKNVIHRNKASRKKSRLS 77

Query: 81 KRLKGI 86
          K++  I
Sbjct: 78 KKINQI 83


>gi|298369894|ref|ZP_06981210.1| ribosomal protein S20 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281354|gb|EFI22843.1| ribosomal protein S20 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S R++ R+ ++   +A+  G    A    +++  VI +
Sbjct: 1  MANSAQARKRARQSVKQRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQAVYKESVKVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG++H N A+R  SRLS ++K +
Sbjct: 61 IADKGVYHKNKAARHKSRLSAKIKAL 86


>gi|260436321|ref|ZP_05790291.1| ribosomal protein S20 [Synechococcus sp. WH 8109]
 gi|260414195|gb|EEX07491.1| ribosomal protein S20 [Synechococcus sp. WH 8109]
          Length = 98

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEA-------CRK 53
          MAN  SAKK I    R  L N++ +SS+R+ M+    A     +    EA        R 
Sbjct: 1  MANNKSAKKRIEIAERNRLRNRTYKSSMRTLMKRCFAACDTYSVTPGDEAKSSVESSMRA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA   G+ H N  + + SRLS  ++ +L  A
Sbjct: 61 AFSKIDKAVKVGVLHRNNGANQKSRLSAAVRKVLEPA 97


>gi|154174486|ref|YP_001407403.1| 30S ribosomal protein S20 [Campylobacter curvus 525.92]
 gi|166223920|sp|A7GW11|RS20_CAMC5 RecName: Full=30S ribosomal protein S20
 gi|112802335|gb|EAT99679.1| ribosomal protein S20 [Campylobacter curvus 525.92]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +RT  N+  R+ +++  +   EA+    +  A EA + A   I  
Sbjct: 1  MANHKSAEKRARQTIKRTERNRFYRTRLKNITKAVREAVEAKDVNTANEALKLANKSIHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            SKG      A+R+VSRL++
Sbjct: 61 FVSKGFLKKQTAARRVSRLAQ 81


>gi|304396519|ref|ZP_07378400.1| ribosomal protein S20 [Pantoea sp. aB]
 gi|308185613|ref|YP_003929744.1| 30S ribosomal protein S20 [Pantoea vagans C9-1]
 gi|304356028|gb|EFM20394.1| ribosomal protein S20 [Pantoea sp. aB]
 gi|308056123|gb|ADO08295.1| 30S ribosomal protein S20 [Pantoea vagans C9-1]
          Length = 87

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASRRSMMRTFVKKVYAAIASGDKAAAQNAFNEMQPLVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  S L+ ++
Sbjct: 61 QAAKGLIHKNKAARYKSNLTAQI 83


>gi|83589441|ref|YP_429450.1| SSU ribosomal protein S20P [Moorella thermoacetica ATCC 39073]
 gi|115305687|sp|Q2RKY2|RS20_MOOTA RecName: Full=30S ribosomal protein S20
 gi|83572355|gb|ABC18907.1| SSU ribosomal protein S20P [Moorella thermoacetica ATCC 39073]
          Length = 105

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 43/81 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          + N  SA K +     RTL NK+ +SSV++ ++    A+  G    A    R+A   I K
Sbjct: 18 VPNIKSAMKRVELTRIRTLRNKAIKSSVKTAIKKFRTALEQGDNHNAAVNLRQAIRAIDK 77

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KG+ H N A+RK S L +
Sbjct: 78 AVTKGVLHPNTAARKKSSLQR 98


>gi|315186665|gb|EFU20424.1| SSU ribosomal protein S20P [Spirochaeta thermophila DSM 6578]
          Length = 88

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA K SA K  R+  +R L NK+ +S +R+ ++    A+  G  E+A    R A   +  
Sbjct: 1  MATK-SALKRHRQSVKRYLRNKAAKSRIRTEVKKFLAAVGEGDKEKAEAQLRVAVKYLDT 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+RK SRL K+L  +
Sbjct: 60 YARKGIIHPNTAARKKSRLYKKLNAM 85


>gi|301167963|emb|CBW27549.1| 30S ribosomal protein S20 [Bacteriovorax marinus SJ]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  R+   RT  N  R+S+ R+ ++    AI       AT    K + ++ +
Sbjct: 1  MANHKSAKKRARQTIVRTARNVQRKSATRNALKAIRSAIESNDKATATGLLAKTQKLLAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
              G+   NAA+RK SRL+ ++  +
Sbjct: 61 LAKHGVIKPNAAARKTSRLASQINNL 86


>gi|315641040|ref|ZP_07896123.1| 30S ribosomal protein S20 [Enterococcus italicus DSM 15952]
 gi|315483209|gb|EFU73722.1| 30S ribosomal protein S20 [Enterococcus italicus DSM 15952]
          Length = 84

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K +R        N S+ S++R+ ++   EA+  G  E      ++A   I  
Sbjct: 1  MPNIESAIKRVRTSEIANAKNSSQTSTMRTAIKKFEEAVAAG-AENVDALYKEAAKAIDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A++KG+ H N ASR  SRLSK++
Sbjct: 60 AETKGLIHKNKASRDKSRLSKKI 82


>gi|228902847|ref|ZP_04066991.1| 30S ribosomal protein S20 [Bacillus thuringiensis IBL 4222]
 gi|228910159|ref|ZP_04073978.1| 30S ribosomal protein S20 [Bacillus thuringiensis IBL 200]
 gi|228941489|ref|ZP_04104039.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228967391|ref|ZP_04128425.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228974419|ref|ZP_04134987.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228981014|ref|ZP_04141316.1| 30S ribosomal protein S20 [Bacillus thuringiensis Bt407]
 gi|228778674|gb|EEM26939.1| 30S ribosomal protein S20 [Bacillus thuringiensis Bt407]
 gi|228785255|gb|EEM33266.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228792317|gb|EEM39885.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228818139|gb|EEM64214.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228849442|gb|EEM94277.1| 30S ribosomal protein S20 [Bacillus thuringiensis IBL 200]
 gi|228856803|gb|EEN01319.1| 30S ribosomal protein S20 [Bacillus thuringiensis IBL 4222]
          Length = 58

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          +RS ++     +T   +E A EA + A   + KA  KG+ H NAASR+ SRL+K++
Sbjct: 1  MRSAVKTVEALVTNNDLENAKEAFKTASKKLDKAARKGLIHQNAASRQKSRLAKQV 56


>gi|118618944|ref|YP_907276.1| 30S ribosomal protein S20 [Mycobacterium ulcerans Agy99]
 gi|183983713|ref|YP_001852004.1| 30S ribosomal protein S20 RpsT [Mycobacterium marinum M]
 gi|166223954|sp|A0PTY6|RS20_MYCUA RecName: Full=30S ribosomal protein S20
 gi|226736526|sp|B2HMC9|RS20_MYCMM RecName: Full=30S ribosomal protein S20
 gi|118571054|gb|ABL05805.1| 30S ribosomal protein S20 RpsT [Mycobacterium ulcerans Agy99]
 gi|183177039|gb|ACC42149.1| 30S ribosomal protein S20 RpsT [Mycobacterium marinum M]
          Length = 87

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  R   R  L NKS +SS+R+ +R   +A   G  E+A E        + K
Sbjct: 1  MANIKSQQKRNRTNERARLRNKSVKSSLRTAVRSFRDAAHSGDKEKAAELLVSTNRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ K S L++ L
Sbjct: 61 AASKGVIHKNQAANKKSALARAL 83


>gi|330977517|gb|EGH77463.1| 30S ribosomal protein S20 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
          Length = 79

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N S RS VR+++++  +AI     E+A  A   A  VI +   KGI H N A+R   RL+
Sbjct: 8  NASLRSMVRTYIKNVVKAIDAKDAEKAQAAYVLAVPVIDRMADKGIIHKNKAARHKGRLN 67

Query: 81 KRLKGILTSA 90
            +K +  +A
Sbjct: 68 GHIKALSLAA 77


>gi|294155519|ref|YP_003559903.1| 30S ribosomal protein S20 [Mycoplasma crocodyli MP145]
 gi|291600071|gb|ADE19567.1| 30S ribosomal protein S20 [Mycoplasma crocodyli MP145]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  + I K+    + N + +S V+  +R A EA+   K E+A E    A S I  
Sbjct: 1  MANIKSKIRSIAKMEEARVRNNAIKSQVKKAIRKAREAV-LAKDEKAMEFVANASSKIAW 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  KG+FH N  +RK SRL 
Sbjct: 60 AVQKGVFHPNKGARKQSRLD 79


>gi|256026971|ref|ZP_05440805.1| SSU ribosomal protein S20P [Fusobacterium sp. D11]
 gi|289764955|ref|ZP_06524333.1| SSU ribosomal protein S20P [Fusobacterium sp. D11]
 gi|289716510|gb|EFD80522.1| SSU ribosomal protein S20P [Fusobacterium sp. D11]
          Length = 90

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    R  + N++ ++ V++  +     I    +E A  A   A     K
Sbjct: 1  MANSKSAKKRILVAERNRVRNQAVKTRVKTMAKKVLSTIEVKDVEAAKTALSVAYKEFDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  ++ S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNSLIVS 89


>gi|217967493|ref|YP_002352999.1| ribosomal protein S20 [Dictyoglomus turgidum DSM 6724]
 gi|226736486|sp|B8E2A8|RS20_DICTD RecName: Full=30S ribosomal protein S20
 gi|217336592|gb|ACK42385.1| ribosomal protein S20 [Dictyoglomus turgidum DSM 6724]
          Length = 93

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I+   R  + N+ R   ++ + +   + +    IEEA +   +  S I K
Sbjct: 1  MANTKSAIKRIKISERNRIRNRVRLGKIKFYTKQFLKFLNENNIEEAKKILPEVISAIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A  KG  H N A+RK S+L K L   L++
Sbjct: 61 AAQKGTLHKNTAARKKSKLMKLLNQKLSA 89


>gi|327439590|dbj|BAK15955.1| ribosomal protein S20 [Solibacillus silvestris StLB046]
          Length = 82

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKR 82
          +R+ ++ A +AI  G  E   E    A   + KA SKG+ H NAASRK SRL+K+
Sbjct: 28 MRTTVKKAEQAIATG-AENTQELVVAASKALDKAASKGLIHKNAASRKKSRLAKK 81


>gi|254526314|ref|ZP_05138366.1| ribosomal protein S20 [Prochlorococcus marinus str. MIT 9202]
 gi|221537738|gb|EEE40191.1| ribosomal protein S20 [Prochlorococcus marinus str. MIT 9202]
          Length = 97

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SAKK I+   R  L NKS +S+VR+  +   E     K E   +       +  K
Sbjct: 1  MANNKSAKKRIQIAERNRLNNKSYKSTVRTLTKKTLENCEKYKKEPNEDNMNLVKTSLNK 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A S+I KA  K + H N  + K S+++K +K  L
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANKKSKINKFVKTTL 94


>gi|229916355|ref|YP_002885001.1| 30S ribosomal protein S20 [Exiguobacterium sp. AT1b]
 gi|259494862|sp|C4L434|RS20_EXISA RecName: Full=30S ribosomal protein S20
 gi|229467784|gb|ACQ69556.1| ribosomal protein S20 [Exiguobacterium sp. AT1b]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +   +R + N   ++++R+ ++  +  +  G  E A EA   A   + K
Sbjct: 1  MANIKSAIKRAKTSEKRRVANSQEKAAMRTAVKRVDALVLEGNKEAAQEAFVLATKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A R  SRL+ R+  +
Sbjct: 61 AASKGLIHKNKAGRDKSRLAARIAAL 86


>gi|167893128|ref|ZP_02480530.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 7894]
 gi|167917854|ref|ZP_02504945.1| 30S ribosomal protein S20 [Burkholderia pseudomallei BCC215]
          Length = 92

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKTVRKAIDAGDQAKAAELFKAATKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRLS  +KG+   A
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAVKGLQAQA 90


>gi|157736353|ref|YP_001489036.1| 30S ribosomal protein S20 [Arcobacter butzleri RM4018]
 gi|315635490|ref|ZP_07890756.1| 30S ribosomal protein S20 [Arcobacter butzleri JV22]
 gi|167011209|sp|A8EQZ3|RS20_ARCB4 RecName: Full=30S ribosomal protein S20
 gi|157698207|gb|ABV66367.1| 30S ribosomal protein S20 [Arcobacter butzleri RM4018]
 gi|315480248|gb|EFU70915.1| 30S ribosomal protein S20 [Arcobacter butzleri JV22]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  R+   +T  N+  ++ +++  +    A+     E+A EA + A      
Sbjct: 1  MANHKSCEKRARQTVVKTERNRFYKTRIKNVTKSVLSAVELADKEKAVEAMKAANQYFHH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKGI     ASRKVSRL  ++  I
Sbjct: 61 CVSKGILKKGTASRKVSRLQLKVNAI 86


>gi|269468099|gb|EEZ79809.1| hypothetical protein Sup05_1171 [uncultured SUP05 cluster
          bacterium]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 48/84 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK  ++  +R   N   R+ VR+F++    A+  G  +EA       + +I +
Sbjct: 1  MANSASSKKRAKQAIKRNQHNSQIRAKVRTFIKKVTYALEAGNKKEAQGGFTIMQKMIDQ 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLK 84
          + SKG+ + + A+RK SRL+ ++K
Sbjct: 61 SVSKGLMNKSQAARKKSRLNAQIK 84


>gi|260913213|ref|ZP_05919695.1| trigger factor [Pasteurella dagmatis ATCC 43325]
 gi|260632800|gb|EEX50969.1| trigger factor [Pasteurella dagmatis ATCC 43325]
          Length = 87

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++    A+  G    A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAAVAAGDKSVAETAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   ++LS ++K +
Sbjct: 61 MASKGLIHANKAANHKAKLSAQIKKL 86


>gi|19553542|ref|NP_601544.1| 30S ribosomal protein S20 [Corynebacterium glutamicum ATCC 13032]
 gi|62391186|ref|YP_226588.1| 30S ribosomal protein S20 [Corynebacterium glutamicum ATCC 13032]
 gi|145296311|ref|YP_001139132.1| 30S ribosomal protein S20 [Corynebacterium glutamicum R]
 gi|23822125|sp|Q8NN66|RS20_CORGL RecName: Full=30S ribosomal protein S20
 gi|166223931|sp|A4QG64|RS20_CORGB RecName: Full=30S ribosomal protein S20
 gi|21325114|dbj|BAB99736.1| Ribosomal protein S20 [Corynebacterium glutamicum ATCC 13032]
 gi|41326526|emb|CAF21008.1| 30S RIBOSOMAL PROTEIN S20 [Corynebacterium glutamicum ATCC 13032]
 gi|140846231|dbj|BAF55230.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 87

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L N++ RS+VR+ +R  N AI  G  + A    R A   + KA +KG+FH N A+ K S 
Sbjct: 19 LRNQAVRSAVRTEIRKFNAAIEAGDKDAAQAQLRTASRALDKAVTKGVFHINNAANKKSN 78

Query: 79 LS 80
          ++
Sbjct: 79 MA 80


>gi|116786149|gb|ABK23997.1| unknown [Picea sitchensis]
 gi|116793101|gb|ABK26614.1| unknown [Picea sitchensis]
          Length = 178

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 4   KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACR----------- 52
            DSA K  R+  +R + NKS +S +++ MR   EA+  GK+++AT               
Sbjct: 74  PDSAAKRARQAEKRRIYNKSHKSEIKTRMRKVFEAL--GKLKKATSPSPEDLIPIEKLIA 131

Query: 53  KAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           +A S I KA   G  H N    + SRLS+R K +
Sbjct: 132 EAYSSIDKAVKVGTLHRNTGGHRKSRLSRRKKVV 165


>gi|53718510|ref|YP_107496.1| 30S ribosomal protein S20 [Burkholderia pseudomallei K96243]
 gi|53725172|ref|YP_102194.1| 30S ribosomal protein S20 [Burkholderia mallei ATCC 23344]
 gi|67642867|ref|ZP_00441618.1| 30S ribosomal protein S20 [Burkholderia mallei GB8 horse 4]
 gi|76809244|ref|YP_332487.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1710b]
 gi|83719209|ref|YP_441291.1| 30S ribosomal protein S20 [Burkholderia thailandensis E264]
 gi|121599438|ref|YP_992023.1| 30S ribosomal protein S20 [Burkholderia mallei SAVP1]
 gi|124384413|ref|YP_001028470.1| 30S ribosomal protein S20 [Burkholderia mallei NCTC 10229]
 gi|126441378|ref|YP_001057970.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 668]
 gi|126450750|ref|YP_001079705.1| 30S ribosomal protein S20 [Burkholderia mallei NCTC 10247]
 gi|126453217|ref|YP_001065204.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1106a]
 gi|134279765|ref|ZP_01766477.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 305]
 gi|166998448|ref|ZP_02264308.1| 30S ribosomal protein S20 [Burkholderia mallei PRL-20]
 gi|167580068|ref|ZP_02372942.1| 30S ribosomal protein S20 [Burkholderia thailandensis TXDOH]
 gi|167618134|ref|ZP_02386765.1| 30S ribosomal protein S20 [Burkholderia thailandensis Bt4]
 gi|167718398|ref|ZP_02401634.1| 30S ribosomal protein S20 [Burkholderia pseudomallei DM98]
 gi|167737445|ref|ZP_02410219.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 14]
 gi|167814564|ref|ZP_02446244.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 91]
 gi|167823036|ref|ZP_02454507.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 9]
 gi|167835687|ref|ZP_02462570.1| 30S ribosomal protein S20 [Burkholderia thailandensis MSMB43]
 gi|167844597|ref|ZP_02470105.1| 30S ribosomal protein S20 [Burkholderia pseudomallei B7210]
 gi|167901588|ref|ZP_02488793.1| 30S ribosomal protein S20 [Burkholderia pseudomallei NCTC 13177]
 gi|167909828|ref|ZP_02496919.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 112]
 gi|217419651|ref|ZP_03451157.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 576]
 gi|226192818|ref|ZP_03788431.1| 30S ribosomal protein S20 [Burkholderia pseudomallei Pakistan 9]
 gi|237811119|ref|YP_002895570.1| ribosomal protein S20 [Burkholderia pseudomallei MSHR346]
 gi|242318097|ref|ZP_04817113.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1106b]
 gi|254176971|ref|ZP_04883628.1| 30S ribosomal protein S20 [Burkholderia mallei ATCC 10399]
 gi|254181541|ref|ZP_04888138.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1655]
 gi|254187499|ref|ZP_04894011.1| 30S ribosomal protein S20 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254196916|ref|ZP_04903340.1| 30S ribosomal protein S20 [Burkholderia pseudomallei S13]
 gi|254203874|ref|ZP_04910234.1| 30S ribosomal protein S20 [Burkholderia mallei FMH]
 gi|254208855|ref|ZP_04915203.1| 30S ribosomal protein S20 [Burkholderia mallei JHU]
 gi|254260421|ref|ZP_04951475.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1710a]
 gi|254296379|ref|ZP_04963836.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 406e]
 gi|254298203|ref|ZP_04965655.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 406e]
 gi|254360090|ref|ZP_04976360.1| 30S ribosomal protein S20 [Burkholderia mallei 2002721280]
 gi|257140039|ref|ZP_05588301.1| 30S ribosomal protein S20 [Burkholderia thailandensis E264]
 gi|59798635|sp|Q62M74|RS20_BURMA RecName: Full=30S ribosomal protein S20
 gi|59798646|sp|Q63WM0|RS20_BURPS RecName: Full=30S ribosomal protein S20
 gi|115305673|sp|Q3JVB6|RS20_BURP1 RecName: Full=30S ribosomal protein S20
 gi|115305675|sp|Q2T0K8|RS20_BURTA RecName: Full=30S ribosomal protein S20
 gi|166223912|sp|A3MHG9|RS20_BURM7 RecName: Full=30S ribosomal protein S20
 gi|166223913|sp|A2S951|RS20_BURM9 RecName: Full=30S ribosomal protein S20
 gi|166223914|sp|A1V1C0|RS20_BURMS RecName: Full=30S ribosomal protein S20
 gi|166223915|sp|A3NS83|RS20_BURP0 RecName: Full=30S ribosomal protein S20
 gi|166223916|sp|A3N6J9|RS20_BURP6 RecName: Full=30S ribosomal protein S20
 gi|52208924|emb|CAH34863.1| putative 30S ribosomal protein S20 [Burkholderia pseudomallei
          K96243]
 gi|52428595|gb|AAU49188.1| ribosomal protein S20 [Burkholderia mallei ATCC 23344]
 gi|76578697|gb|ABA48172.1| ribosomal protein S20 [Burkholderia pseudomallei 1710b]
 gi|83653034|gb|ABC37097.1| ribosomal protein S20 [Burkholderia thailandensis E264]
 gi|121228248|gb|ABM50766.1| ribosomal protein S20 [Burkholderia mallei SAVP1]
 gi|124292433|gb|ABN01702.1| 30S ribosomal protein S20 [Burkholderia mallei NCTC 10229]
 gi|126220871|gb|ABN84377.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 668]
 gi|126226859|gb|ABN90399.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1106a]
 gi|126243620|gb|ABO06713.1| 30S ribosomal protein S20 [Burkholderia mallei NCTC 10247]
 gi|134248965|gb|EBA49047.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 305]
 gi|147745386|gb|EDK52466.1| 30S ribosomal protein S20 [Burkholderia mallei FMH]
 gi|147750731|gb|EDK57800.1| 30S ribosomal protein S20 [Burkholderia mallei JHU]
 gi|148029330|gb|EDK87235.1| 30S ribosomal protein S20 [Burkholderia mallei 2002721280]
 gi|157805766|gb|EDO82936.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 406e]
 gi|157808183|gb|EDO85353.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 406e]
 gi|157935179|gb|EDO90849.1| 30S ribosomal protein S20 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160698012|gb|EDP87982.1| 30S ribosomal protein S20 [Burkholderia mallei ATCC 10399]
 gi|169653659|gb|EDS86352.1| 30S ribosomal protein S20 [Burkholderia pseudomallei S13]
 gi|184212079|gb|EDU09122.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1655]
 gi|217396955|gb|EEC36971.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 576]
 gi|225935068|gb|EEH31042.1| 30S ribosomal protein S20 [Burkholderia pseudomallei Pakistan 9]
 gi|237504207|gb|ACQ96525.1| ribosomal protein S20 [Burkholderia pseudomallei MSHR346]
 gi|238524074|gb|EEP87509.1| 30S ribosomal protein S20 [Burkholderia mallei GB8 horse 4]
 gi|242141336|gb|EES27738.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1106b]
 gi|243065504|gb|EES47690.1| 30S ribosomal protein S20 [Burkholderia mallei PRL-20]
 gi|254219110|gb|EET08494.1| 30S ribosomal protein S20 [Burkholderia pseudomallei 1710a]
          Length = 92

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDQAKAAELFKAATKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRLS  +KG+   A
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAVKGLQAQA 90


>gi|312879849|ref|ZP_07739649.1| SSU ribosomal protein S20P [Aminomonas paucivorans DSM 12260]
 gi|310783140|gb|EFQ23538.1| SSU ribosomal protein S20P [Aminomonas paucivorans DSM 12260]
          Length = 92

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 50/90 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SA K +    R  L N+  ++  ++ ++   EA+  G  + A +   +A+SV+ K
Sbjct: 1  MPNKKSAAKRVLVAERNRLYNRFWKTRCKNAVKKVLEAVAQGDKDLAGKRLVEAQSVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A  KG+ H N A+R+ S ++ ++  +L +A
Sbjct: 61 AVVKGVIHRNTAARRKSGVAAKVHVLLKTA 90


>gi|237743403|ref|ZP_04573884.1| SSU ribosomal protein S20P [Fusobacterium sp. 7_1]
 gi|260494979|ref|ZP_05815108.1| ribosomal protein S20 [Fusobacterium sp. 3_1_33]
 gi|229433182|gb|EEO43394.1| SSU ribosomal protein S20P [Fusobacterium sp. 7_1]
 gi|260197422|gb|EEW94940.1| ribosomal protein S20 [Fusobacterium sp. 3_1_33]
          Length = 90

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    R  + N++ ++ V++  +     I    +E A  A   A     K
Sbjct: 1  MANSKSAKKRILVAERNRVRNQAVKTRVKTMAKKVLSTIEVKDVEAAKAALSVAYKEFDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  ++ S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNSLIVS 89


>gi|111221438|ref|YP_712232.1| 30S ribosomal protein S20 [Frankia alni ACN14a]
 gi|111148970|emb|CAJ60650.1| 30S ribosomal protein S20 [Frankia alni ACN14a]
          Length = 103

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L NK+ +S +++ +R   +A+  G  E A E  R A   + KA SKG+ H N A+ K
Sbjct: 30 KRRLRNKAVKSELKTHVRRFRDAVEAGDAERAGETLRVASRKLDKAVSKGVIHPNQAANK 89

Query: 76 VSRLSK 81
           S L++
Sbjct: 90 KSALAR 95


>gi|268608304|ref|ZP_06142031.1| ribosomal protein S20 [Ruminococcus flavefaciens FD-1]
          Length = 85

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 53/83 (63%), Gaps = 2/83 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK ++  A +   NK+R+S++++ ++ A+ A+  G+ +E  EA + A   + +
Sbjct: 1  MPNIKSAKKRVKVNATKAAANKARKSNLKTILKKADAAVAAGENQE--EAIKVAIKRVDQ 58

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A + G+ H N A+RK S+L+K+L
Sbjct: 59 ACAHGLMHKNKAARKKSQLAKKL 81


>gi|257463157|ref|ZP_05627558.1| SSU ribosomal protein S20P [Fusobacterium sp. D12]
          Length = 86

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 8/87 (9%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV--- 57
          MAN  SAKK +  +A R   N+ R  +V+S ++  N+ +     E+  E  + A SV   
Sbjct: 1  MANSKSAKKRV-AVAER---NRQRNQAVKSRVKTMNKKVVVAVQEQDVETAKNALSVAYK 56

Query: 58 -IQKAKSKGIFHGNAASRKVSRLSKRL 83
           + KA SKGI   N ASRK +RL+ ++
Sbjct: 57 ELDKAVSKGIIKKNTASRKKARLAAKV 83


>gi|56752514|ref|YP_173215.1| 30S ribosomal protein S20 [Synechococcus elongatus PCC 6301]
 gi|81300329|ref|YP_400537.1| 30S ribosomal protein S20 [Synechococcus elongatus PCC 7942]
 gi|62510986|sp|Q5MZ25|RS20_SYNP6 RecName: Full=30S ribosomal protein S20
 gi|118574564|sp|Q31N19|RS20_SYNE7 RecName: Full=30S ribosomal protein S20
 gi|56687473|dbj|BAD80695.1| 30S ribosomal protein S20 [Synechococcus elongatus PCC 6301]
 gi|81169210|gb|ABB57550.1| SSU ribosomal protein S20P [Synechococcus elongatus PCC 7942]
          Length = 98

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEATEACRK---- 53
          MAN  SA K ++   R  L NK+ +S+V++ ++H   A +A      E A +A  +    
Sbjct: 1  MANIKSAIKRVQIAERNRLRNKAYKSAVKTLVKHCFTAFDAYAADPNETARQAVNERLSA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSK 81
          A S I KA  +G+ H N  +RK +RL+K
Sbjct: 61 AYSKIDKAVKRGVLHANTGARKKARLAK 88


>gi|296130063|ref|YP_003637313.1| ribosomal protein S20 [Cellulomonas flavigena DSM 20109]
 gi|296021878|gb|ADG75114.1| ribosomal protein S20 [Cellulomonas flavigena DSM 20109]
          Length = 86

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I    +  L NK+ +S +++++R   EA+  G  E A+ A   A   + K
Sbjct: 1  MANIKSQIKRIGTNEKARLRNKAVKSELKTYVRRVREAVAGGDKEAASTALVAAARKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S LSK + G+
Sbjct: 61 AVSKGVIHANQAANRKSALSKAVNGL 86


>gi|291616220|ref|YP_003518962.1| RpsT [Pantoea ananatis LMG 20103]
 gi|291151250|gb|ADD75834.1| RpsT [Pantoea ananatis LMG 20103]
 gi|327392671|dbj|BAK10093.1| 30S ribosomal subunit protein S20 RpsT [Pantoea ananatis AJ13355]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASRRSMMRTFVKKVYAAIASGDKAAAQNAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARYKANLTAQI 83


>gi|268678717|ref|YP_003303148.1| ribosomal protein S20 [Sulfurospirillum deleyianum DSM 6946]
 gi|268616748|gb|ACZ11113.1| ribosomal protein S20 [Sulfurospirillum deleyianum DSM 6946]
          Length = 91

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K IR+  +RT  N+  ++ +++  +   EA+  G    A  A +        
Sbjct: 1  MANHKSAEKRIRQTKKRTERNRFYKTRIKNLTKAVKEAVEAGDQAAAALALKNVNKSFHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            SKG+   N A+R+VSRL++
Sbjct: 61 YSSKGVLPKNTAARRVSRLAQ 81


>gi|294101691|ref|YP_003553549.1| ribosomal protein S20 [Aminobacterium colombiense DSM 12261]
 gi|293616671|gb|ADE56825.1| ribosomal protein S20 [Aminobacterium colombiense DSM 12261]
          Length = 96

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SA+K +R   +  L N+   S  ++  +   EA+     E A +  + A+SVI K
Sbjct: 1  MPNKKSAEKRMRTSEKNRLYNRYWTSRCKTAAKRVLEAVNNQDAELAGKRLQVAQSVIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A  KG+ H +  +R+ S L+ ++K +  +A
Sbjct: 61 AVVKGVMHRSTGARRKSLLTNKVKALAGAA 90


>gi|153855245|ref|ZP_01996411.1| hypothetical protein DORLON_02425 [Dorea longicatena DSM 13814]
 gi|149752244|gb|EDM62175.1| hypothetical protein DORLON_02425 [Dorea longicatena DSM 13814]
          Length = 94

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 22/29 (75%)

Query: 58 IQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          I KA SKG++H N  SRK+SRL+K + GI
Sbjct: 65 INKAGSKGVYHKNTCSRKISRLTKAVNGI 93


>gi|311693400|gb|ADP96273.1| ribosomal protein S20 [marine bacterium HP15]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS  R++++     I  G  EEA  A ++A+ ++  
Sbjct: 1  MANSPQAKKRARQNEKNRKHNASLRSMARTYVKKIQSKIEAGNYEEAQAAFQQAQPILDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGIF  N  +R  SRLS ++K +
Sbjct: 61 MVNKGIFAKNKVARSKSRLSAKIKAL 86


>gi|308233988|ref|ZP_07664725.1| ribosomal protein S20 [Atopobium vaginae DSM 15829]
 gi|328944003|ref|ZP_08241468.1| trigger factor [Atopobium vaginae DSM 15829]
 gi|327491972|gb|EGF23746.1| trigger factor [Atopobium vaginae DSM 15829]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  + NK+ RS +++ ++    A+    +E+A  A ++A  ++ K
Sbjct: 1  MANIKSQKKRILTAEKARIRNKAVRSELKTAVKEVRLAVEAADLEKAQAAVKRAGRLLDK 60

Query: 61 AKSKGIFHGNAASRKVS 77
          A SKGI H N A+++ S
Sbjct: 61 AASKGIIHKNQAAQRKS 77


>gi|41408322|ref|NP_961158.1| 30S ribosomal protein S20 [Mycobacterium avium subsp.
          paratuberculosis K-10]
 gi|118464716|ref|YP_880995.1| 30S ribosomal protein S20 [Mycobacterium avium 104]
 gi|254774588|ref|ZP_05216104.1| 30S ribosomal protein S20 [Mycobacterium avium subsp. avium ATCC
          25291]
 gi|59798799|sp|Q73XT5|RS20_MYCPA RecName: Full=30S ribosomal protein S20
 gi|166223948|sp|A0QDK7|RS20_MYCA1 RecName: Full=30S ribosomal protein S20
 gi|41396678|gb|AAS04541.1| RpsT [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|48928134|gb|AAT47745.1| probable 30S ribosomal protein S20 [Mycobacterium avium]
 gi|118166003|gb|ABK66900.1| ribosomal protein S20 [Mycobacterium avium 104]
          Length = 86

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  +   R  L NKS +SS+R+ +R   EA   G  E+A E        + K
Sbjct: 1  MANIKSQQKRNKTNERARLRNKSVKSSLRTAVRAFREAAHAGDKEKAAELLVSTNRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ K S L++ L
Sbjct: 61 AASKGVIHKNQAANKKSALAQAL 83


>gi|317060750|ref|ZP_07925235.1| SSU ribosomal protein S20P [Fusobacterium sp. D12]
 gi|313686426|gb|EFS23261.1| SSU ribosomal protein S20P [Fusobacterium sp. D12]
          Length = 91

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 8/87 (9%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV--- 57
          MAN  SAKK +  +A R   N+ R  +V+S ++  N+ +     E+  E  + A SV   
Sbjct: 6  MANSKSAKKRV-AVAER---NRQRNQAVKSRVKTMNKKVVVAVQEQDVETAKNALSVAYK 61

Query: 58 -IQKAKSKGIFHGNAASRKVSRLSKRL 83
           + KA SKGI   N ASRK +RL+ ++
Sbjct: 62 ELDKAVSKGIIKKNTASRKKARLAAKV 88


>gi|261493884|ref|ZP_05990396.1| 30S ribosomal protein S20 [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|261495150|ref|ZP_05991614.1| 30S ribosomal protein S20 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|261309220|gb|EEY10459.1| 30S ribosomal protein S20 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|261310486|gb|EEY11677.1| 30S ribosomal protein S20 [Mannheimia haemolytica serotype A2
          str. BOVINE]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N S+RS +R+F++    A+T G    A  A  + + V+ +
Sbjct: 3  LANIKSAKKRAVQSEKRRQHNASQRSMMRTFIKKVYAAVTAGDKAAAQTAFVEMQKVVDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SK + H N A+   S+L+ ++K +
Sbjct: 63 MASKNLIHANKAANHKSKLAAQIKKL 88


>gi|288916980|ref|ZP_06411352.1| ribosomal protein S20 [Frankia sp. EUN1f]
 gi|288351689|gb|EFC85894.1| ribosomal protein S20 [Frankia sp. EUN1f]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L NK+ +S +++ +R   +A+  G  E A  A R A   + KA SKG+ H N A+ +
Sbjct: 16 KRRLRNKAVKSELKTHVRRFRDAVEAGDSERADAAFRLAAKKLDKAASKGVIHPNQAANR 75

Query: 76 VSRLSKRLKGI 86
           S ++K   GI
Sbjct: 76 KSAMAKANAGI 86


>gi|260881515|ref|ZP_05404599.2| ribosomal protein S20 [Mitsuokella multacida DSM 20544]
 gi|260848641|gb|EEX68648.1| ribosomal protein S20 [Mitsuokella multacida DSM 20544]
          Length = 91

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 8/80 (10%)

Query: 11 IRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEA----TEACRKAESVIQKAKSKGI 66
          ++  A+R   N + +S VR+  R   +A+  G  +EA    T AC+     I +A +  +
Sbjct: 14 VKSDAKRHAKNAAEKSRVRTASRRVLDAVEAGNADEAKSLLTVACK----TIDQAAANKV 69

Query: 67 FHGNAASRKVSRLSKRLKGI 86
          +H NAA+RK SRL++++  +
Sbjct: 70 YHKNAAARKKSRLARKVNAL 89


>gi|88855049|ref|ZP_01129714.1| 30S ribosomal protein S20 [marine actinobacterium PHSC20C1]
 gi|88815577|gb|EAR25434.1| 30S ribosomal protein S20 [marine actinobacterium PHSC20C1]
          Length = 86

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N++ +S V++ +R   EAIT G  E AT     A   + KA  KG+ H N A+ + S ++
Sbjct: 21 NRAVKSQVKTAIRATREAITAGDKETATARLLAATKTLDKAAGKGVLHKNQAANRKSAIA 80

Query: 81 KRLKGI 86
          K++  +
Sbjct: 81 KQVAAL 86


>gi|302528888|ref|ZP_07281230.1| ribosomal protein S20 [Streptomyces sp. AA4]
 gi|302437783|gb|EFL09599.1| ribosomal protein S20 [Streptomyces sp. AA4]
          Length = 86

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKR 82
          RSSV++ +R   EA   G  ++A E  R A   + KA +KG+ H N A+ K S L+KR
Sbjct: 25 RSSVKTAIRKFREAAEAGDKDKALELQRDAARKLDKAVTKGVIHANQAANKKSALAKR 82


>gi|157414089|ref|YP_001484955.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9215]
 gi|167011214|sp|A8G6Y8|RS20_PROM2 RecName: Full=30S ribosomal protein S20
 gi|157388664|gb|ABV51369.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. MIT 9215]
          Length = 97

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 47/95 (49%), Gaps = 7/95 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SAKK I+   R  L NKS +S+VR+  +   E     K E   +       +  K
Sbjct: 1  MANNKSAKKRIQIAERNRLNNKSYKSTVRTLTKKTLENCEKYKKEPNEDNMNLVKTSLNK 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILT 88
          A S+I KA  K + H N  + K S+++K +K  L 
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANKKSKINKFVKTALN 95


>gi|150015707|ref|YP_001307961.1| 30S ribosomal protein S20 [Clostridium beijerinckii NCIMB 8052]
 gi|189044855|sp|A6LRM5|RS20_CLOB8 RecName: Full=30S ribosomal protein S20
 gi|149902172|gb|ABR33005.1| ribosomal protein S20 [Clostridium beijerinckii NCIMB 8052]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I+    +TL N+  +S++++ ++    AI     EEA          +  
Sbjct: 1  MANIKSAKKRIKVTETKTLKNRMIKSALKTTIKKFEAAIEAKNNEEAKALFTSVVKSLDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N A+RK SRL+ +L  +
Sbjct: 61 AATKGVVHKNMAARKKSRLAAKLNSM 86


>gi|308273589|emb|CBX30191.1| 30S ribosomal protein S20 [uncultured Desulfobacterium sp.]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEA-TEACRKAESVIQ 59
          +AN  SA K  R+   R L NKS ++ V++ ++   E     + +E   ++   A+S+I 
Sbjct: 3  LANHKSALKRARQDEVRRLRNKSIKTRVKNIIKDIRETANKNESKEVFLKSLDAAKSIID 62

Query: 60 KAKSKGIFHGNAASRKVSRLSK 81
          K+  KG+ H   A+RK+SRLSK
Sbjct: 63 KSAKKGVIHKRTAARKISRLSK 84


>gi|188532857|ref|YP_001906654.1| 30S ribosomal protein S20 [Erwinia tasmaniensis Et1/99]
 gi|226736495|sp|B2VGR4|RS20_ERWT9 RecName: Full=30S ribosomal protein S20
 gi|188027899|emb|CAO95756.1| 30S ribosomal protein S20 [Erwinia tasmaniensis Et1/99]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASRRSMMRTFIKKVYAAIATGDKAAAQNAFNEMQPLVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|126666692|ref|ZP_01737669.1| ribosomal protein S20 [Marinobacter sp. ELB17]
 gi|126628737|gb|EAZ99357.1| ribosomal protein S20 [Marinobacter sp. ELB17]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   +KK  R+       N S RS  R++M+  +  I  G  E A  A  +A+ ++  
Sbjct: 1  MANSPQSKKRARQNENSRKHNTSLRSMARTYMKKIHVQIAEGNYEGAKAAFLQAQPILDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGIF  N  +R  SRL+ ++K +
Sbjct: 61 MINKGIFPKNKVARIKSRLNIKVKAL 86


>gi|145628097|ref|ZP_01783898.1| 30S ribosomal protein S20 [Haemophilus influenzae 22.1-21]
 gi|145638212|ref|ZP_01793822.1| 30S ribosomal protein S20 [Haemophilus influenzae PittII]
 gi|144979872|gb|EDJ89531.1| 30S ribosomal protein S20 [Haemophilus influenzae 22.1-21]
 gi|145272541|gb|EDK12448.1| 30S ribosomal protein S20 [Haemophilus influenzae PittII]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAVGEKSAAEAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|328957262|ref|YP_004374648.1| 30S ribosomal protein S20 [Carnobacterium sp. 17-4]
 gi|328673586|gb|AEB29632.1| 30S ribosomal protein S20 [Carnobacterium sp. 17-4]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K +R   +  + N  ++SS+R+ ++   ++I  G  E + +  ++A   I  
Sbjct: 4  MPNIESAIKRVRTSEKSAVQNNVQKSSMRTAIKKYAQSIEAGN-ENSEQLLKEAIKAIDM 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+R  SRL+ +L
Sbjct: 63 AASKGLIHKNKANRDKSRLTAKL 85


>gi|15827246|ref|NP_301509.1| 30S ribosomal protein S20 [Mycobacterium leprae TN]
 gi|221229724|ref|YP_002503140.1| 30S ribosomal protein S20 [Mycobacterium leprae Br4923]
 gi|3122815|sp|O33132|RS20_MYCLE RecName: Full=30S ribosomal protein S20
 gi|254813092|sp|B8ZUR8|RS20_MYCLB RecName: Full=30S ribosomal protein S20
 gi|2398689|emb|CAB16149.1| 30s ribosomal protein s20 [Mycobacterium leprae]
 gi|13092795|emb|CAC30112.1| 30S ribosomal protein S20 [Mycobacterium leprae]
 gi|219932831|emb|CAR70697.1| 30S ribosomal protein S20 [Mycobacterium leprae Br4923]
          Length = 86

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S +K  R   R  L NKS +SS+R+ +R   EA+  G+ E+A +        + K
Sbjct: 1  MTNIKSQQKRNRTNERARLRNKSVKSSLRTAVRAFREAVHAGEKEKAAKLLVSTSRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ K S L++ L
Sbjct: 61 AASKGVIHKNQAANKKSALARTL 83


>gi|19705184|ref|NP_602679.1| SSU ribosomal protein S20P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|296328258|ref|ZP_06870787.1| 30S ribosomal protein S20 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
 gi|22096107|sp|Q8RHW1|RS20_FUSNN RecName: Full=30S ribosomal protein S20
 gi|19713125|gb|AAL93978.1| SSU ribosomal protein S20P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|296154562|gb|EFG95350.1| 30S ribosomal protein S20 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
          Length = 90

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 46/89 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    R  + N++ ++ V++  +     I    +E A  A   A     K
Sbjct: 1  MANSKSAKKRILVAERNRVRNQAVKTRVKTMAKKVLSTIEVKDVEAAKVALSVAYKEFDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  +++S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNSLVSS 89


>gi|237739595|ref|ZP_04570076.1| SSU ribosomal protein S20P [Fusobacterium sp. 2_1_31]
 gi|294783348|ref|ZP_06748672.1| ribosomal protein S20 [Fusobacterium sp. 1_1_41FAA]
 gi|229423203|gb|EEO38250.1| SSU ribosomal protein S20P [Fusobacterium sp. 2_1_31]
 gi|294480226|gb|EFG28003.1| ribosomal protein S20 [Fusobacterium sp. 1_1_41FAA]
          Length = 90

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +    R  + N++ ++ V++  +     +    +E A  A   A   + K
Sbjct: 1  MANSKSAKKRVLVAERNRVRNQAVKTRVKTMAKKVLATLELKDVEAAKTALSVAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  ++ S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNSLVNS 89


>gi|317125281|ref|YP_004099393.1| 30S ribosomal protein S20P [Intrasporangium calvum DSM 43043]
 gi|315589369|gb|ADU48666.1| SSU ribosomal protein S20P [Intrasporangium calvum DSM 43043]
          Length = 86

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +RT  NK+ +S +R+++R    A+  G  + A +A + A   + K
Sbjct: 1  MANIKSQLKRIKTNEKRTERNKAVKSELRTWVRKFRVAVASGDKDAAADALKTASKKLDK 60

Query: 61 AKSKGIFHGN 70
          A SKG+ H N
Sbjct: 61 AVSKGVIHQN 70


>gi|292489408|ref|YP_003532295.1| 30S ribosomal protein S20 [Erwinia amylovora CFBP1430]
 gi|292898374|ref|YP_003537743.1| 30S ribosomal protein S20 [Erwinia amylovora ATCC 49946]
 gi|283477203|emb|CAY73110.1| 30S ribosomal protein S20 [Erwinia pyrifoliae DSM 12163]
 gi|291198222|emb|CBJ45328.1| 30S ribosomal protein S20 [Erwinia amylovora ATCC 49946]
 gi|291554842|emb|CBA22716.1| 30S ribosomal protein S20 [Erwinia amylovora CFBP1430]
 gi|312173573|emb|CBX81827.1| 30S ribosomal protein S20 [Erwinia amylovora ATCC BAA-2158]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N SRRS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASRRSMMRTFIKKVYAAIATGDKAAAQNAFNEMQPLVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLAAQI 83


>gi|159904150|ref|YP_001551494.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9211]
 gi|226695402|sp|A9BCH8|RS20_PROM4 RecName: Full=30S ribosomal protein S20
 gi|159889326|gb|ABX09540.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. MIT 9211]
          Length = 100

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 9/98 (9%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACR-------- 52
          MAN +SAKK I+   R  L N+S +S++R+ M+    A     +E+  E  +        
Sbjct: 1  MANNNSAKKRIQIAERNRLQNRSYKSAMRTLMKRCLTA-AGSYLEKPGEEAKANLQQNIN 59

Query: 53 KAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          +A S I KA  KG+ H N  + K SRL+  +K ++  A
Sbjct: 60 EAFSKIDKAVKKGVLHRNNGANKKSRLNAAVKKLIEPA 97


>gi|281412570|ref|YP_003346649.1| ribosomal protein S20 [Thermotoga naphthophila RKU-10]
 gi|281373673|gb|ADA67235.1| ribosomal protein S20 [Thermotoga naphthophila RKU-10]
          Length = 96

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEAT-EACRKAESVIQ 59
          M N  SAKK +R   +R L NK+ ++  ++ ++   +AI   + +E   E  RKA++ I 
Sbjct: 1  MPNIKSAKKRVRVSEKRRLRNKAYKTFFKNRIKEVLKAIENKEPKEVVLELTRKAQAAID 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          KA SK + H N  +R+ +RL +++   L +
Sbjct: 61 KAVSKRVIHKNQGARRKARLFEKVNEYLKT 90


>gi|159029169|emb|CAO87529.1| rpsT [Microcystis aeruginosa PCC 7806]
          Length = 97

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 7/93 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAIT-FGK------IEEATEACRK 53
          MAN  SA K ++   R  L NK+ +S+VR+ ++    A++ +G       +E A +A  +
Sbjct: 1  MANTKSALKRVQISERNRLRNKAYKSAVRTLIKKCLVAVSAYGANPSPEGLESAQQALSE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          A S I KA  + + H N  +RK + L+K L+ +
Sbjct: 61 AYSKIDKAVKRNVLHQNNGARKKASLAKALQKV 93


>gi|87201350|ref|YP_498607.1| 30S ribosomal protein S20 [Novosphingobium aromaticivorans DSM
          12444]
 gi|115305695|sp|Q2G300|RS20_NOVAD RecName: Full=30S ribosomal protein S20
 gi|87137031|gb|ABD27773.1| SSU ribosomal protein S20P [Novosphingobium aromaticivorans DSM
          12444]
          Length = 86

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K IR+  RR  IN +R S +R+F++    A+  G    A EA + A+  + +
Sbjct: 1  MANTPQARKRIRRNERRAEINGNRLSRIRTFVKKVETALAGGDKTAAAEALKAAQPELAR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            ++G+ H N  +RK+SRL+KR+
Sbjct: 61 GVARGVLHKNTVARKMSRLTKRV 83


>gi|260890408|ref|ZP_05901671.1| ribosomal protein S20 [Leptotrichia hofstadii F0254]
 gi|260860028|gb|EEX74528.1| ribosomal protein S20 [Leptotrichia hofstadii F0254]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  S+KK +    R    N++ RS  R+F++    A+    ++EA  A + A   + K
Sbjct: 1  MAHSKSSKKRVFIGERNAARNQAIRSRTRTFVKKVLAAVEAKNVDEAKSALQVAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+   N ASRK SRL+ ++  +
Sbjct: 61 AVTKGVIKKNTASRKKSRLTLKVNSL 86


>gi|148270264|ref|YP_001244724.1| 30S ribosomal protein S20 [Thermotoga petrophila RKU-1]
 gi|166223998|sp|A5ILS5|RS20_THEP1 RecName: Full=30S ribosomal protein S20
 gi|147735808|gb|ABQ47148.1| SSU ribosomal protein S20P [Thermotoga petrophila RKU-1]
          Length = 96

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEAT-EACRKAESVIQ 59
          M N  SAKK +R   +R L NK+ ++  ++ ++   +AI   + +E   E  RKA++ I 
Sbjct: 1  MPNIKSAKKRVRVSEKRRLRNKAYKTFFKNRIKEVLKAIENKEPKEVVLELTRKAQAAID 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          KA SK + H N  +R+ +RL +++   L
Sbjct: 61 KAVSKRVIHKNQGARRKARLFEKVNEYL 88


>gi|32491045|ref|NP_871299.1| hypothetical protein WGLp296 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31340411|sp|Q8D2Q8|RS20_WIGBR RecName: Full=30S ribosomal protein S20
 gi|25166252|dbj|BAC24442.1| rpsT [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK   +  ++   N S++S +RSF++    +I   + +    +  + +S++ +
Sbjct: 1  MANIKSSKKRSIQSEKKRKYNSSKKSMIRSFIKKVKNSILKKEKDTINNSFIEMQSILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
             K + H N ASR  SRLSK++K I 
Sbjct: 61 YAKKNLIHKNKASRLKSRLSKKIKFIF 87


>gi|68304937|gb|AAY89948.1| predicted ribosomal protein S20 [uncultured bacterium BAC13K9BAC]
          Length = 86

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K +R+ A+  + N +++S  R+ ++    +I+    E++ +    A S I K
Sbjct: 1  MANTAQARKRVRQAAKARISNAAKKSEFRTSIKKVLGSISDKNAEQSKKDYITAVSCIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ ++K +
Sbjct: 61 LAAKGLIHKNKAARHKSRLNSKIKSL 86


>gi|194290625|ref|YP_002006532.1| 30S ribosomal protein s20 [Cupriavidus taiwanensis LMG 19424]
 gi|193224460|emb|CAQ70471.1| 30S ribosomal subunit protein S20 [Cupriavidus taiwanensis LMG
          19424]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   +   N S RS +R+ ++   +AI  G    A E  + +++VI  
Sbjct: 1  MANSAQARKRARQAVAQNAHNSSLRSRLRTAVKAVRKAIDAGDKAAAAEIFKNSQAVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAIKAM 86


>gi|74317872|ref|YP_315612.1| 30S ribosomal protein S20P [Thiobacillus denitrificans ATCC
          25259]
 gi|90111926|sp|Q3SHS6|RS20_THIDA RecName: Full=30S ribosomal protein S20
 gi|74057367|gb|AAZ97807.1| ribosomal protein S20p [Thiobacillus denitrificans ATCC 25259]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ + +   N S+RS +R+ ++   +AI  G    A    + + SVI  
Sbjct: 1  MANSAQARKRARQASAQRDHNMSQRSELRTAIKKVRKAIEAGDKAAAQAVYQSSVSVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +KG+
Sbjct: 61 IADKQIIHKNKAARHKSRLSLAVKGM 86


>gi|325290549|ref|YP_004266730.1| SSU ribosomal protein S20P [Syntrophobotulus glycolicus DSM 8271]
 gi|324965950|gb|ADY56729.1| SSU ribosomal protein S20P [Syntrophobotulus glycolicus DSM 8271]
          Length = 92

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +     R L N + +S++++ +R   EA+  G  E A EA RKA   + K
Sbjct: 3  MPNIKSAVKRVELSKIRNLKNSAAKSALKTTIRRFEEALAAGP-EGAAEALRKATRALDK 61

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+R+ SRL+K+L
Sbjct: 62 AASKGLIHKNQAARRKSRLTKKL 84


>gi|161723307|ref|NP_246598.2| 30S ribosomal protein S20 [Pasteurella multocida subsp. multocida
          str. Pm70]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++    A+  G    A +A  + + V+ +
Sbjct: 1  MANIKSAKKRAIQSEKRRQHNASQRSMMRTYIKKVYAAVAAGDKSVAEKAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   + LS ++K +
Sbjct: 61 MASKGLIHANKAANHKANLSAQIKKL 86


>gi|300866791|ref|ZP_07111471.1| 30S ribosomal protein S20 [Oscillatoria sp. PCC 6506]
 gi|300335200|emb|CBN56631.1| 30S ribosomal protein S20 [Oscillatoria sp. PCC 6506]
          Length = 99

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-------TFGKIEEATEACRK 53
          M N  SA K +    R  L NK+ +S+V++ M+    A+       T   +E+  +   +
Sbjct: 1  MPNIKSAIKRVEIAERNRLENKAYKSAVKTLMKKYLAAVDTYAAAPTPESMEQVQQRMSE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
          A S I KA  +G+ H N   RK SRL+K LK
Sbjct: 61 AFSKIDKAVKRGVLHRNNGDRKKSRLAKALK 91


>gi|123969223|ref|YP_001010081.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. AS9601]
 gi|166223969|sp|A2BT63|RS20_PROMS RecName: Full=30S ribosomal protein S20
 gi|123199333|gb|ABM70974.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. AS9601]
          Length = 97

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SAKK I+   R  L+NKS +S+VR+  +   E     K     +       +  K
Sbjct: 1  MANNKSAKKRIQIAERNRLMNKSYKSTVRTLTKKTLENCEKYKKNPNEDNKNLVKTSLNK 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A S+I KA  K + H N  + + S+++  +K  LT+
Sbjct: 61 AFSLIDKAVKKNVLHKNNGANRKSKINNFVKTTLTT 96


>gi|269123307|ref|YP_003305884.1| 30S ribosomal protein S20 [Streptobacillus moniliformis DSM
          12112]
 gi|268314633|gb|ACZ01007.1| ribosomal protein S20 [Streptobacillus moniliformis DSM 12112]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  S+KK I    R  L N++  S V++F++    A+    I++A  A   A   + K
Sbjct: 1  MAHTKSSKKRIVIGERNRLRNQAITSRVKTFVKKVLAAVDSKNIDDAKAALSVAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+   N ASR  SRL+ ++K +
Sbjct: 61 AVTKGVLKKNTASRTKSRLATKVKAL 86


>gi|22298731|ref|NP_681978.1| 30S ribosomal protein S20 [Thermosynechococcus elongatus BP-1]
 gi|34222863|sp|Q8DJN4|RS20_THEEB RecName: Full=30S ribosomal protein S20
 gi|22294912|dbj|BAC08740.1| 30S ribosomal protein S20 [Thermosynechococcus elongatus BP-1]
          Length = 98

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-------TFGKIEEATEACRK 53
          MAN  SA K  +   R  L NK+ RS+VR+ +++   AI       T  K+ E       
Sbjct: 1  MANIKSAAKRAQIAERNRLRNKAYRSAVRTLIKNYLNAISQYSTDPTPEKLAEVHHRLNL 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA  +G+ H N  +R+ +RL++ L   L  A
Sbjct: 61 AFSKIDKAVKRGVLHRNTGARRKARLTRILNKTLQPA 97


>gi|294788573|ref|ZP_06753815.1| ribosomal protein S20 [Simonsiella muelleri ATCC 29453]
 gi|294483450|gb|EFG31135.1| ribosomal protein S20 [Simonsiella muelleri ATCC 29453]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N S R++ R+ ++   +A+  G    A  + R+   ++ +
Sbjct: 1  MANSAQARKRARQSLKARAHNASLRTAFRTAVKKVLKAVEAGDKAAAQASYRENTKILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAKIKAM 86


>gi|289644666|ref|ZP_06476729.1| ribosomal protein S20 [Frankia symbiont of Datisca glomerata]
 gi|289505512|gb|EFD26548.1| ribosomal protein S20 [Frankia symbiont of Datisca glomerata]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L NK+ +S +++ +R   EA+  G  E A    R A   + KA SKG+ H N A+ K
Sbjct: 16 KRRLRNKAVKSELKTLIRRFREAVEAGDQERAGLELRIASRKLDKAVSKGVIHANQAANK 75

Query: 76 VSRLSKR 82
           S L+ R
Sbjct: 76 KSALATR 82


>gi|293606248|ref|ZP_06688611.1| trigger factor [Achromobacter piechaudii ATCC 43553]
 gi|292815395|gb|EFF74513.1| trigger factor [Achromobacter piechaudii ATCC 43553]
          Length = 99

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R   N S RS +R+ ++   ++I  G    A +  +KA SVI +
Sbjct: 13 MANTAQARKRARQSVERNKHNSSLRSMLRTAIKRVRQSIAAGDKAAAGDVFQKASSVIDR 72

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRL+  +K +
Sbjct: 73 VADKNIIHKNKAARHKSRLAAAIKAL 98


>gi|257068895|ref|YP_003155150.1| 30S ribosomal protein S20P [Brachybacterium faecium DSM 4810]
 gi|256559713|gb|ACU85560.1| SSU ribosomal protein S20P [Brachybacterium faecium DSM 4810]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L N++ +S ++++ R    A++ G  E A EA + A   + KA SKG+ H N A+ + S 
Sbjct: 19 LRNRAVKSELKTYTRKVKAAVSTGDAEVAGEALKTASRKLDKAVSKGVIHRNQAANRKSG 78

Query: 79 LSK 81
          L+K
Sbjct: 79 LAK 81


>gi|145589936|ref|YP_001156533.1| ribosomal protein S20 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|189044875|sp|A4SZQ5|RS20_POLSQ RecName: Full=30S ribosomal protein S20
 gi|145048342|gb|ABP34969.1| SSU ribosomal protein S20P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS +R+ ++   +AI  G    A +     ++ I K
Sbjct: 1  MANTAQARKRARQAVKQNEHNSSLRSKLRTSIKAVRKAIETGDKAAAAKVFAATQATIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N ASR+ SRLS  +K +
Sbjct: 61 IADKKIAHKNTASRQKSRLSAAIKAM 86


>gi|271963809|ref|YP_003338005.1| 30S ribosomal protein S20 [Streptosporangium roseum DSM 43021]
 gi|270506984|gb|ACZ85262.1| 30S ribosomal protein S20 [Streptosporangium roseum DSM 43021]
          Length = 90

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R+  +  L NK+ +SS+++ +R   EA   G ++EA    R A   + K
Sbjct: 1  MANIKSQIKRNRQNEKARLRNKAVKSSLKTAVRKFREAADQGNVDEAVVLQRAACRQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ + S +++R+
Sbjct: 61 AASKGVIHKNQAANRKSAIAQRV 83


>gi|227551299|ref|ZP_03981348.1| ribosomal protein S20 [Enterococcus faecium TX1330]
 gi|257878129|ref|ZP_05657782.1| ribosomal protein S20 [Enterococcus faecium 1,230,933]
 gi|257881086|ref|ZP_05660739.1| ribosomal protein S20 [Enterococcus faecium 1,231,502]
 gi|257884748|ref|ZP_05664401.1| ribosomal protein S20 [Enterococcus faecium 1,231,501]
 gi|257887584|ref|ZP_05667237.1| ribosomal protein S20 [Enterococcus faecium 1,141,733]
 gi|257889672|ref|ZP_05669325.1| ribosomal protein S20 [Enterococcus faecium 1,231,410]
 gi|257896080|ref|ZP_05675733.1| ribosomal protein S20 [Enterococcus faecium Com12]
 gi|257898716|ref|ZP_05678369.1| ribosomal protein S20 [Enterococcus faecium Com15]
 gi|258616370|ref|ZP_05714140.1| ribosomal protein S20 [Enterococcus faecium DO]
 gi|260559177|ref|ZP_05831363.1| ribosomal protein S20 [Enterococcus faecium C68]
 gi|261207711|ref|ZP_05922396.1| ribosomal protein S20 [Enterococcus faecium TC 6]
 gi|289566287|ref|ZP_06446718.1| 30S ribosomal protein S20 [Enterococcus faecium D344SRF]
 gi|293377496|ref|ZP_06623692.1| ribosomal protein S20 [Enterococcus faecium PC4.1]
 gi|293552884|ref|ZP_06673542.1| ribosomal protein S20 [Enterococcus faecium E1039]
 gi|293563907|ref|ZP_06678330.1| ribosomal protein S20 [Enterococcus faecium E1162]
 gi|293569411|ref|ZP_06680708.1| ribosomal protein S20 [Enterococcus faecium E1071]
 gi|293571935|ref|ZP_06682949.1| ribosomal protein S20 [Enterococcus faecium E980]
 gi|294615859|ref|ZP_06695701.1| ribosomal protein S20 [Enterococcus faecium E1636]
 gi|294617294|ref|ZP_06696935.1| ribosomal protein S20 [Enterococcus faecium E1679]
 gi|294623510|ref|ZP_06702358.1| ribosomal protein S20 [Enterococcus faecium U0317]
 gi|314937544|ref|ZP_07844872.1| ribosomal protein S20 [Enterococcus faecium TX0133a04]
 gi|314941464|ref|ZP_07848353.1| ribosomal protein S20 [Enterococcus faecium TX0133C]
 gi|314949644|ref|ZP_07852965.1| ribosomal protein S20 [Enterococcus faecium TX0082]
 gi|314951826|ref|ZP_07854864.1| ribosomal protein S20 [Enterococcus faecium TX0133A]
 gi|314992771|ref|ZP_07858175.1| ribosomal protein S20 [Enterococcus faecium TX0133B]
 gi|314996528|ref|ZP_07861566.1| ribosomal protein S20 [Enterococcus faecium TX0133a01]
 gi|227179579|gb|EEI60551.1| ribosomal protein S20 [Enterococcus faecium TX1330]
 gi|257812357|gb|EEV41115.1| ribosomal protein S20 [Enterococcus faecium 1,230,933]
 gi|257816744|gb|EEV44072.1| ribosomal protein S20 [Enterococcus faecium 1,231,502]
 gi|257820586|gb|EEV47734.1| ribosomal protein S20 [Enterococcus faecium 1,231,501]
 gi|257823638|gb|EEV50570.1| ribosomal protein S20 [Enterococcus faecium 1,141,733]
 gi|257826032|gb|EEV52658.1| ribosomal protein S20 [Enterococcus faecium 1,231,410]
 gi|257832645|gb|EEV59066.1| ribosomal protein S20 [Enterococcus faecium Com12]
 gi|257836628|gb|EEV61702.1| ribosomal protein S20 [Enterococcus faecium Com15]
 gi|260074934|gb|EEW63250.1| ribosomal protein S20 [Enterococcus faecium C68]
 gi|260078094|gb|EEW65800.1| ribosomal protein S20 [Enterococcus faecium TC 6]
 gi|289161927|gb|EFD09796.1| 30S ribosomal protein S20 [Enterococcus faecium D344SRF]
 gi|291587937|gb|EFF19788.1| ribosomal protein S20 [Enterococcus faecium E1071]
 gi|291591245|gb|EFF22912.1| ribosomal protein S20 [Enterococcus faecium E1636]
 gi|291596451|gb|EFF27703.1| ribosomal protein S20 [Enterococcus faecium E1679]
 gi|291597104|gb|EFF28307.1| ribosomal protein S20 [Enterococcus faecium U0317]
 gi|291603018|gb|EFF33212.1| ribosomal protein S20 [Enterococcus faecium E1039]
 gi|291604140|gb|EFF33651.1| ribosomal protein S20 [Enterococcus faecium E1162]
 gi|291607953|gb|EFF37261.1| ribosomal protein S20 [Enterococcus faecium E980]
 gi|292643865|gb|EFF61979.1| ribosomal protein S20 [Enterococcus faecium PC4.1]
 gi|313589314|gb|EFR68159.1| ribosomal protein S20 [Enterococcus faecium TX0133a01]
 gi|313592704|gb|EFR71549.1| ribosomal protein S20 [Enterococcus faecium TX0133B]
 gi|313596000|gb|EFR74845.1| ribosomal protein S20 [Enterococcus faecium TX0133A]
 gi|313599716|gb|EFR78559.1| ribosomal protein S20 [Enterococcus faecium TX0133C]
 gi|313643087|gb|EFS07667.1| ribosomal protein S20 [Enterococcus faecium TX0133a04]
 gi|313643983|gb|EFS08563.1| ribosomal protein S20 [Enterococcus faecium TX0082]
          Length = 84

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K +R      + N S+ S++R+ ++   +A+  G  +      ++A   I  
Sbjct: 1  MPNIESAIKRVRTSENANVKNSSQTSAMRTAIKKFEDAVASG-ADNVDALYKEAVKAIDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A+SKG+ H N A+R  SRLSK++
Sbjct: 60 AESKGLIHKNKANRDKSRLSKKI 82


>gi|212702605|ref|ZP_03310733.1| hypothetical protein DESPIG_00631 [Desulfovibrio piger ATCC
          29098]
 gi|212674046|gb|EEB34529.1| hypothetical protein DESPIG_00631 [Desulfovibrio piger ATCC
          29098]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++  +    N++ R+ V++ ++    AIT    E+A+ A   A SV+ K
Sbjct: 1  MANHKSAIKRHKQSLKHAARNRAARTRVKNAVKAVRAAITGNDKEQASSALTVAASVLAK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG  H   A+RK+SRLS+ +  I
Sbjct: 61 AAGKGAMHWKKAARKLSRLSRAVNAI 86


>gi|88813008|ref|ZP_01128251.1| Ribosomal protein S20p [Nitrococcus mobilis Nb-231]
 gi|88789786|gb|EAR20910.1| Ribosomal protein S20p [Nitrococcus mobilis Nb-231]
          Length = 62

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          +R+ ++    A+  G  E+A EA R+A  ++ +   KG+ H N A+R+ SRL+K ++ +
Sbjct: 2  MRTAVKKVLHALNSGDQEKAGEAYRQAVPIVDRMAGKGLIHKNKAARQKSRLNKHIRAL 60


>gi|302879195|ref|YP_003847759.1| 30S ribosomal protein S20 [Gallionella capsiferriformans ES-2]
 gi|302581984|gb|ADL55995.1| ribosomal protein S20 [Gallionella capsiferriformans ES-2]
          Length = 87

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 42/86 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS +R+ ++   +AI  G    A    R + S +  
Sbjct: 1  MANSAQARKRARQAVKQNAHNSSLRSELRTAIKRVIKAIEAGDKTAAQSVYRDSVSTVDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N ASR  SRLS  +K +
Sbjct: 61 IADKKIIHKNKASRHKSRLSAAIKAM 86


>gi|269120542|ref|YP_003308719.1| ribosomal protein S20 [Sebaldella termitidis ATCC 33386]
 gi|268614420|gb|ACZ08788.1| ribosomal protein S20 [Sebaldella termitidis ATCC 33386]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  S+KK +    R  + N++ +S V++F++    A+    ++EA  A   A   + K
Sbjct: 1  MAHSKSSKKRVYIGERNRIRNQAIKSRVKTFVKKVLVAVDANNVDEAKTALSVAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI   N  SRK SRL+ ++  +
Sbjct: 61 AVTKGILKKNTVSRKKSRLAAKVNSL 86


>gi|152967365|ref|YP_001363149.1| ribosomal protein S20 [Kineococcus radiotolerans SRS30216]
 gi|189044868|sp|A6WDJ6|RS20_KINRD RecName: Full=30S ribosomal protein S20
 gi|151361882|gb|ABS04885.1| ribosomal protein S20 [Kineococcus radiotolerans SRS30216]
          Length = 86

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  L NK+ +S +R+ +R   EA+  G  E+A  A   A   + K
Sbjct: 1  MANIKSQKKRILTNEKARLRNKAVKSELRTVVRGFREALAAGDAEKAQAALALASKKLDK 60

Query: 61 AKSKGIFHGNAAS 73
          A SKG+ H N A+
Sbjct: 61 AVSKGVIHKNQAA 73


>gi|328955420|ref|YP_004372753.1| SSU ribosomal protein S20P [Coriobacterium glomerans PW2]
 gi|328455744|gb|AEB06938.1| SSU ribosomal protein S20P [Coriobacterium glomerans PW2]
          Length = 87

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 49/86 (56%), Gaps = 11/86 (12%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK IR   R  + N+S RS +++ ++H + A+     E+ +EA + A +V  K
Sbjct: 1  MANIKSQKKRIRTNERARMRNRSVRSELKTLIKHVHMAVE----EQDSEAAKTAATVAYK 56

Query: 61 ----AKSKGIFHGN-AASRK--VSRL 79
              A +KGI H N AA+RK  V RL
Sbjct: 57 RLDMAAAKGIIHKNQAANRKSGVQRL 82


>gi|113869019|ref|YP_727508.1| 30S ribosomal protein S20 [Ralstonia eutropha H16]
 gi|113527795|emb|CAJ94140.1| SSU ribosomal protein S20 [Ralstonia eutropha H16]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   +   N S RS +R+ ++   +AI  G    A E  + +++VI  
Sbjct: 1  MANSAQARKRARQAVAQNAHNSSLRSRLRTAVKAVRKAIDAGDKAAAAEIFKNSQAVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAIKSM 86


>gi|224015728|ref|XP_002297512.1| RR20, ribosomal protein 20 30S small ribosomal subunit,
          chloroplast, translation, protein biosynthesis
          [Thalassiosira pseudonana CCMP1335]
 gi|220967776|gb|EED86152.1| RR20, ribosomal protein 20 30S small ribosomal subunit,
          chloroplast, translation, protein biosynthesis
          [Thalassiosira pseudonana CCMP1335]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SAKK I    R  L N+  +SSVR+  +     +   KI ++     K +     
Sbjct: 1  MANNKSAKKRILITKRNNLQNRFYKSSVRTLTKRFLSDLETYKISQSNTDKDKLQNGLSS 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRLS 80
            S+I K   K ++H N A+RK S+L+
Sbjct: 61 IYSLIDKGYKKNVYHKNTAARKKSKLA 87


>gi|319897521|ref|YP_004135718.1| 30S ribosomal subunit protein s20 [Haemophilus influenzae F3031]
 gi|317433027|emb|CBY81398.1| 30S ribosomal subunit protein S20 [Haemophilus influenzae F3031]
          Length = 87

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVVAGEKSAAEAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|167856015|ref|ZP_02478760.1| 30S ribosomal protein S20 [Haemophilus parasuis 29755]
 gi|219871504|ref|YP_002475879.1| 30S ribosomal protein S20 [Haemophilus parasuis SH0165]
 gi|254813100|sp|B8F6H9|RS20_HAEPS RecName: Full=30S ribosomal protein S20
 gi|167852854|gb|EDS24123.1| 30S ribosomal protein S20 [Haemophilus parasuis 29755]
 gi|219691708|gb|ACL32931.1| 30S ribosomal protein S20 [Haemophilus parasuis SH0165]
          Length = 87

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K   +  +R   N S+RS +R+F++    A+  G    +  A  + + V+ +
Sbjct: 1  MANIKSAQKRAVQSEKRRQHNASQRSMMRTFIKKVYAAVATGDKAASEAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|256375345|ref|YP_003099005.1| ribosomal protein S20 [Actinosynnema mirum DSM 43827]
 gi|255919648|gb|ACU35159.1| ribosomal protein S20 [Actinosynnema mirum DSM 43827]
          Length = 86

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NK+ +SS+++ +R   EA   G  ++A    + A   + K
Sbjct: 1  MANIKSQLKRIKTNEKARLRNKAVKSSLKTAIRKFREAAEAGDKDKALALVQDASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ K S ++KR   I
Sbjct: 61 AVSKGVIHANQAANKKSAMAKRANQI 86


>gi|161761271|ref|YP_248665.2| 30S ribosomal protein S20 [Haemophilus influenzae 86-028NP]
          Length = 87

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAESAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|262066730|ref|ZP_06026342.1| ribosomal protein S20 [Fusobacterium periodonticum ATCC 33693]
 gi|291379529|gb|EFE87047.1| ribosomal protein S20 [Fusobacterium periodonticum ATCC 33693]
          Length = 90

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK +    R  + N++ ++ V++  +     +    +E A  A   A   + K
Sbjct: 1  MANSKSAKKRVLVAERNRVRNQAVKTRVKTMAKKVLATLEVKDVEAAKTALSVAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  ++ S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNSLVNS 89


>gi|311031607|ref|ZP_07709697.1| 30S ribosomal protein S20 [Bacillus sp. m3-13]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    R   N + +SS+R+ ++     +    +E A  A  +A   + K
Sbjct: 1  MPNIKSAIKRVKTNDVRRAHNATIKSSMRTAVKKVEAFVANNDVEGAKTAYLEAAKRLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A   GI H NAA+R+ SRL+K++ G
Sbjct: 61 AAQNGIIHKNAANRQKSRLAKKVNG 85


>gi|228916954|ref|ZP_04080515.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228923075|ref|ZP_04086367.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228929366|ref|ZP_04092389.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228935642|ref|ZP_04098456.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228948035|ref|ZP_04110320.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228954608|ref|ZP_04116632.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228960590|ref|ZP_04122238.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228987573|ref|ZP_04147691.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228993065|ref|ZP_04152988.1| 30S ribosomal protein S20 [Bacillus pseudomycoides DSM 12442]
 gi|228999115|ref|ZP_04158697.1| 30S ribosomal protein S20 [Bacillus mycoides Rock3-17]
 gi|229025788|ref|ZP_04182187.1| 30S ribosomal protein S20 [Bacillus cereus AH1272]
 gi|229031971|ref|ZP_04187957.1| 30S ribosomal protein S20 [Bacillus cereus AH1271]
 gi|229051289|ref|ZP_04194807.1| 30S ribosomal protein S20 [Bacillus cereus AH676]
 gi|229071828|ref|ZP_04205042.1| 30S ribosomal protein S20 [Bacillus cereus F65185]
 gi|229075996|ref|ZP_04208969.1| 30S ribosomal protein S20 [Bacillus cereus Rock4-18]
 gi|229081584|ref|ZP_04214081.1| 30S ribosomal protein S20 [Bacillus cereus Rock4-2]
 gi|229093392|ref|ZP_04224497.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-42]
 gi|229098793|ref|ZP_04229731.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-29]
 gi|229104953|ref|ZP_04235609.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-28]
 gi|229111795|ref|ZP_04241342.1| 30S ribosomal protein S20 [Bacillus cereus Rock1-15]
 gi|229117819|ref|ZP_04247183.1| 30S ribosomal protein S20 [Bacillus cereus Rock1-3]
 gi|229123861|ref|ZP_04253054.1| 30S ribosomal protein S20 [Bacillus cereus 95/8201]
 gi|229129602|ref|ZP_04258571.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-Cer4]
 gi|229141060|ref|ZP_04269602.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-ST26]
 gi|229148169|ref|ZP_04276475.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-ST24]
 gi|229152524|ref|ZP_04280715.1| 30S ribosomal protein S20 [Bacillus cereus m1550]
 gi|229157936|ref|ZP_04286009.1| 30S ribosomal protein S20 [Bacillus cereus ATCC 4342]
 gi|229163267|ref|ZP_04291222.1| 30S ribosomal protein S20 [Bacillus cereus R309803]
 gi|229174997|ref|ZP_04302516.1| 30S ribosomal protein S20 [Bacillus cereus MM3]
 gi|229180599|ref|ZP_04307941.1| 30S ribosomal protein S20 [Bacillus cereus 172560W]
 gi|229186562|ref|ZP_04313723.1| 30S ribosomal protein S20 [Bacillus cereus BGSC 6E1]
 gi|229192533|ref|ZP_04319495.1| 30S ribosomal protein S20 [Bacillus cereus ATCC 10876]
 gi|229198450|ref|ZP_04325154.1| 30S ribosomal protein S20 [Bacillus cereus m1293]
 gi|228584953|gb|EEK43067.1| 30S ribosomal protein S20 [Bacillus cereus m1293]
 gi|228590957|gb|EEK48814.1| 30S ribosomal protein S20 [Bacillus cereus ATCC 10876]
 gi|228596821|gb|EEK54480.1| 30S ribosomal protein S20 [Bacillus cereus BGSC 6E1]
 gi|228603023|gb|EEK60502.1| 30S ribosomal protein S20 [Bacillus cereus 172560W]
 gi|228608458|gb|EEK65761.1| 30S ribosomal protein S20 [Bacillus cereus MM3]
 gi|228620330|gb|EEK77201.1| 30S ribosomal protein S20 [Bacillus cereus R309803]
 gi|228625544|gb|EEK82298.1| 30S ribosomal protein S20 [Bacillus cereus ATCC 4342]
 gi|228630955|gb|EEK87593.1| 30S ribosomal protein S20 [Bacillus cereus m1550]
 gi|228635309|gb|EEK91833.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-ST24]
 gi|228642338|gb|EEK98627.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-ST26]
 gi|228653870|gb|EEL09739.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-Cer4]
 gi|228659575|gb|EEL15222.1| 30S ribosomal protein S20 [Bacillus cereus 95/8201]
 gi|228665616|gb|EEL21094.1| 30S ribosomal protein S20 [Bacillus cereus Rock1-3]
 gi|228671669|gb|EEL26966.1| 30S ribosomal protein S20 [Bacillus cereus Rock1-15]
 gi|228678447|gb|EEL32668.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-28]
 gi|228684637|gb|EEL38577.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-29]
 gi|228689986|gb|EEL43789.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-42]
 gi|228701740|gb|EEL54229.1| 30S ribosomal protein S20 [Bacillus cereus Rock4-2]
 gi|228707108|gb|EEL59308.1| 30S ribosomal protein S20 [Bacillus cereus Rock4-18]
 gi|228711307|gb|EEL63268.1| 30S ribosomal protein S20 [Bacillus cereus F65185]
 gi|228722047|gb|EEL73474.1| 30S ribosomal protein S20 [Bacillus cereus AH676]
 gi|228729361|gb|EEL80352.1| 30S ribosomal protein S20 [Bacillus cereus AH1271]
 gi|228735496|gb|EEL86092.1| 30S ribosomal protein S20 [Bacillus cereus AH1272]
 gi|228760732|gb|EEM09696.1| 30S ribosomal protein S20 [Bacillus mycoides Rock3-17]
 gi|228766713|gb|EEM15353.1| 30S ribosomal protein S20 [Bacillus pseudomycoides DSM 12442]
 gi|228772171|gb|EEM20619.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228799103|gb|EEM46072.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228805054|gb|EEM51649.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228811621|gb|EEM57957.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228824002|gb|EEM69820.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228830272|gb|EEM75886.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228836573|gb|EEM81922.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228842675|gb|EEM87762.1| 30S ribosomal protein S20 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
          Length = 58

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          +RS ++     +T   +E A EA + A   + KA  KG+ H NAA+R+ SRL+K++
Sbjct: 1  MRSAVKTVEALVTNNDLENAKEAFKTASKKLDKAARKGLIHQNAAARQKSRLAKQV 56


>gi|226311590|ref|YP_002771484.1| 30S ribosomal protein S20 [Brevibacillus brevis NBRC 100599]
 gi|254813050|sp|C0ZB21|RS20_BREBN RecName: Full=30S ribosomal protein S20
 gi|226094538|dbj|BAH42980.1| 30S ribosomal protein S20 [Brevibacillus brevis NBRC 100599]
          Length = 91

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K  + I +R     S++S +R+ +++  +A+    +  A      A   + K
Sbjct: 1  MPNIKSAIKRTKTIEKRRAHRASQKSDLRTSIKNFEKAVAASDVALAKSTLLVAVKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H NAA+R+ SRL K+L
Sbjct: 61 AASKGLIHKNAANRQKSRLMKKL 83


>gi|114567106|ref|YP_754260.1| 30S ribosomal protein S20 [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
 gi|122317903|sp|Q0AWL5|RS20_SYNWW RecName: Full=30S ribosomal protein S20
 gi|114338041|gb|ABI68889.1| SSU ribosomal protein S20P [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 40/68 (58%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L NK+ +S +++ +++   AI    ++ A+    +  S++ ++ +KGI H N  +RK S 
Sbjct: 19 LRNKAYKSKLKTAIKNYENAIIAEDLDTASNKLLQVTSLLDRSITKGILHKNNVARKKSA 78

Query: 79 LSKRLKGI 86
          LSK+L  I
Sbjct: 79 LSKKLNSI 86


>gi|172038403|ref|YP_001804904.1| 30S ribosomal protein S20 [Cyanothece sp. ATCC 51142]
 gi|254813109|sp|B1WZT9|RS20_CYAA5 RecName: Full=30S ribosomal protein S20
 gi|171699857|gb|ACB52838.1| 30S ribosomal protein S20 [Cyanothece sp. ATCC 51142]
          Length = 97

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEA-------CRK 53
          MAN  SA K IR   R  L NKS +S+VR+ M+   +A+         E           
Sbjct: 1  MANSKSALKRIRTSERNRLRNKSYKSAVRTLMKKYLQAVEEYAASPTPENKAVVDQRMSA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          A S I KA  + + H N  +RK +RL+K L+ +
Sbjct: 61 AYSKIDKAVKRSVLHRNNGARKKARLAKALQQV 93


>gi|187925177|ref|YP_001896819.1| 30S ribosomal protein S20 [Burkholderia phytofirmans PsJN]
 gi|226736463|sp|B2SY60|RS20_BURPP RecName: Full=30S ribosomal protein S20
 gi|187716371|gb|ACD17595.1| ribosomal protein S20 [Burkholderia phytofirmans PsJN]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + +   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDKAKAAEIFQASSKTIDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+  SA
Sbjct: 61 IADKNIVHKNKAARHKSRLAAAIKGLQASA 90


>gi|299830555|ref|YP_003735003.1| 30S ribosomal protein S20 [Durinskia baltica]
 gi|297384919|gb|ADI40218.1| 30S ribosomal protein S20 [Durinskia baltica]
          Length = 93

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SAKK I    R  L NK  ++SVR+ ++     +   K  +  E  +K +     
Sbjct: 1  MANNKSAKKRIEINKRNRLRNKYYKTSVRTLIKLFFANLEIYKTSQTVEDKKKVQDILNS 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRL 79
            S++ K   K IFH N A+RK ++L
Sbjct: 61 VYSLMDKGTKKNIFHKNLAARKKAKL 86


>gi|78213585|ref|YP_382364.1| 30S ribosomal protein S20 [Synechococcus sp. CC9605]
 gi|118574566|sp|Q3AHX3|RS20_SYNSC RecName: Full=30S ribosomal protein S20
 gi|78198044|gb|ABB35809.1| ribosomal protein S20 [Synechococcus sp. CC9605]
          Length = 98

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEA----TEACRK 53
          MAN  SAKK I    R  L N++ +SS+R+ M+    A +A +    +EA      + R 
Sbjct: 1  MANNKSAKKRIEIAERNRLRNRTYKSSMRTLMKRCFAACDAYSATPGDEAKASVQTSMRA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA   G+ H N  + + SRLS  ++ +L  A
Sbjct: 61 AFSKIDKAVKVGVLHRNNGANQKSRLSAAVRKVLEPA 97


>gi|171914598|ref|ZP_02930068.1| 30S ribosomal protein S20 [Verrucomicrobium spinosum DSM 4136]
          Length = 90

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S++K IR+   RTL N++ +S +R+  +    A+  G    A  A  +  S   K
Sbjct: 1  MANIRSSEKDIRRTQTRTLRNQANKSRIRTLRKKVLGAVAKGDATAAQTAYNEFASAADK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A    + H N ASR  SR++ +L
Sbjct: 61 AAKTKVLHKNTASRLKSRVAAQL 83


>gi|126653871|ref|ZP_01725718.1| ribosomal protein S20 [Bacillus sp. B14905]
 gi|126589596|gb|EAZ83735.1| ribosomal protein S20 [Bacillus sp. B14905]
          Length = 82

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +  + N   +S++R+ ++ A  A+     E   E  + A   + K
Sbjct: 1  MPNIKSAIKRVKVNEKANIANSQAKSAMRTTVKKAENAVA-DNAENKQELLQAAFKSLDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKR 82
          A SKG+ H NAA+RK SRL+K+
Sbjct: 60 AASKGLIHKNAAARKKSRLAKK 81


>gi|254303349|ref|ZP_04970707.1| ribosomal protein S20 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|148323541|gb|EDK88791.1| ribosomal protein S20 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    R  + N++ ++ V++  +     +    +E A  A   A     K
Sbjct: 1  MANSKSAKKRILVAERNRVRNQAVKTRVKTMAKKVLATLEVKDVEAAKAALSVAYKEFDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  ++ S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNALVNS 89


>gi|290580440|ref|YP_003484832.1| putative 30S ribosomal protein S20 [Streptococcus mutans NN2025]
 gi|24377504|gb|AAN58820.1|AE014950_3 putative 30S ribosomal protein S20 [Streptococcus mutans UA159]
 gi|254997339|dbj|BAH87940.1| putative 30S ribosomal protein S20 [Streptococcus mutans NN2025]
          Length = 84

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 11/59 (18%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          RS++++F  + NE           E  R A S I KAKSKG+ H N ASR  +RL+ +L
Sbjct: 35 RSAIKAFEANPNE-----------ELFRAASSSIDKAKSKGLIHKNKASRDKARLASKL 82


>gi|167561809|ref|ZP_02354725.1| 30S ribosomal protein S20 [Burkholderia oklahomensis EO147]
 gi|167569032|ref|ZP_02361906.1| 30S ribosomal protein S20 [Burkholderia oklahomensis C6786]
          Length = 92

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDHAKAAEVFKVATKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+   A
Sbjct: 61 IADKKIVHKNKAARHKSRLAAAVKGLQAQA 90


>gi|30995413|ref|NP_439126.2| 30S ribosomal protein S20 [Haemophilus influenzae Rd KW20]
 gi|145630061|ref|ZP_01785843.1| 30S ribosomal protein S20 [Haemophilus influenzae R3021]
 gi|145632351|ref|ZP_01788086.1| 30S ribosomal protein S20 [Haemophilus influenzae 3655]
 gi|145634143|ref|ZP_01789854.1| 30S ribosomal protein S20 [Haemophilus influenzae PittAA]
 gi|145637270|ref|ZP_01792931.1| 30S ribosomal protein S20 [Haemophilus influenzae PittHH]
 gi|145640635|ref|ZP_01796218.1| 30S ribosomal protein S20 [Haemophilus influenzae R3021]
 gi|148826385|ref|YP_001291138.1| 30S ribosomal protein S20 [Haemophilus influenzae PittEE]
 gi|229843974|ref|ZP_04464115.1| 30S ribosomal protein S20 [Haemophilus influenzae 6P18H1]
 gi|229846025|ref|ZP_04466137.1| 30S ribosomal protein S20 [Haemophilus influenzae 7P49H1]
 gi|319775099|ref|YP_004137587.1| 30S ribosomal subunit protein S20 [Haemophilus influenzae F3047]
 gi|329122988|ref|ZP_08251559.1| trigger factor [Haemophilus aegyptius ATCC 11116]
 gi|1173229|sp|P44959|RS20_HAEIN RecName: Full=30S ribosomal protein S20
 gi|166223940|sp|A5UDA4|RS20_HAEIE RecName: Full=30S ribosomal protein S20
 gi|144984342|gb|EDJ91765.1| 30S ribosomal protein S20 [Haemophilus influenzae R3021]
 gi|144987258|gb|EDJ93788.1| 30S ribosomal protein S20 [Haemophilus influenzae 3655]
 gi|145268587|gb|EDK08580.1| 30S ribosomal protein S20 [Haemophilus influenzae PittAA]
 gi|145269522|gb|EDK09464.1| 30S ribosomal protein S20 [Haemophilus influenzae PittHH]
 gi|145274561|gb|EDK14424.1| 30S ribosomal protein S20 [Haemophilus influenzae 22.4-21]
 gi|148716545|gb|ABQ98755.1| 30S ribosomal protein S20 [Haemophilus influenzae PittEE]
 gi|229811029|gb|EEP46746.1| 30S ribosomal protein S20 [Haemophilus influenzae 7P49H1]
 gi|229812968|gb|EEP48656.1| 30S ribosomal protein S20 [Haemophilus influenzae 6P18H1]
 gi|301169690|emb|CBW29291.1| 30S ribosomal subunit protein S20 [Haemophilus influenzae 10810]
 gi|317449690|emb|CBY85897.1| 30S ribosomal subunit protein S20 [Haemophilus influenzae F3047]
 gi|327471919|gb|EGF17359.1| trigger factor [Haemophilus aegyptius ATCC 11116]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAEAAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|312795225|ref|YP_004028147.1| SSU ribosomal protein S20P [Burkholderia rhizoxinica HKI 454]
 gi|312167000|emb|CBW74003.1| SSU ribosomal protein S20P [Burkholderia rhizoxinica HKI 454]
          Length = 91

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS +R+ ++   +AI  G   +A E  +++   +  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKMRTAIKAVRKAIESGDKAKAAEVLKQSSKTLDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+  +A
Sbjct: 61 IADKKIIHKNKAARHKSRLAAAIKGLAQAA 90


>gi|296315095|ref|ZP_06865036.1| ribosomal protein S20 [Neisseria polysaccharea ATCC 43768]
 gi|296838003|gb|EFH21941.1| ribosomal protein S20 [Neisseria polysaccharea ATCC 43768]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S R++ R+ ++   +A+  G    A    +++  +I  
Sbjct: 1  MANSAQARKRARQSVKQRAHNASLRTAFRTAVKKVLKAVEAGDKAAAQAVYQESVKIIDC 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAKVKAL 86


>gi|225021712|ref|ZP_03710904.1| hypothetical protein CORMATOL_01740 [Corynebacterium matruchotii
          ATCC 33806]
 gi|305681161|ref|ZP_07403968.1| ribosomal protein S20 [Corynebacterium matruchotii ATCC 14266]
 gi|224945408|gb|EEG26617.1| hypothetical protein CORMATOL_01740 [Corynebacterium matruchotii
          ATCC 33806]
 gi|305659366|gb|EFM48866.1| ribosomal protein S20 [Corynebacterium matruchotii ATCC 14266]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK +    +R   N++ RS+VR+ +R   EA+  G    A    R A   + K
Sbjct: 1  MANIKSQKKRVLTNEKRRQRNQAIRSAVRTEIRKFREAVASGDKAAAEAQLRVASRAMDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A +KG+FH N  + K S+++
Sbjct: 61 AVTKGVFHRNNGANKKSKMA 80


>gi|303257096|ref|ZP_07343110.1| ribosomal protein S20 [Burkholderiales bacterium 1_1_47]
 gi|331000951|ref|ZP_08324588.1| ribosomal protein S20 [Parasutterella excrementihominis YIT
          11859]
 gi|302860587|gb|EFL83664.1| ribosomal protein S20 [Burkholderiales bacterium 1_1_47]
 gi|329569910|gb|EGG51667.1| ribosomal protein S20 [Parasutterella excrementihominis YIT
          11859]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 1  MAN-KDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59
          MAN K + K+ I+ +AR   ++ ++RS  R+ +++  +AI  G    A      A+SVI 
Sbjct: 1  MANSKQARKRAIQAVARNKHLS-AQRSRYRTAIKNVRKAILAGDKAAAQTLYVTAQSVID 59

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGI 86
              KG+ H NAA+R  SRL   +K +
Sbjct: 60 SMADKGVLHKNAAARHKSRLVVAIKAM 86


>gi|161511520|ref|NP_874317.2| 30S ribosomal protein S20 [Haemophilus ducreyi 35000HP]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R+F++    AI  G    +  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTFIKKVYAAIATGDKAASQTAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   ++L  ++K +
Sbjct: 61 MASKGLIHANKAANHKAKLVAQIKKL 86


>gi|34764180|ref|ZP_00145044.1| SSU ribosomal protein S20P [Fusobacterium nucleatum subsp.
          vincentii ATCC 49256]
 gi|237741302|ref|ZP_04571783.1| SSU ribosomal protein S20P [Fusobacterium sp. 4_1_13]
 gi|256846441|ref|ZP_05551898.1| ribosomal protein S20 [Fusobacterium sp. 3_1_36A2]
 gi|294784491|ref|ZP_06749780.1| ribosomal protein S20 [Fusobacterium sp. 3_1_27]
 gi|27886048|gb|EAA23360.1| SSU ribosomal protein S20P [Fusobacterium nucleatum subsp.
          vincentii ATCC 49256]
 gi|229430834|gb|EEO41046.1| SSU ribosomal protein S20P [Fusobacterium sp. 4_1_13]
 gi|256718210|gb|EEU31766.1| ribosomal protein S20 [Fusobacterium sp. 3_1_36A2]
 gi|294487707|gb|EFG35066.1| ribosomal protein S20 [Fusobacterium sp. 3_1_27]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK I    R  + N++ ++ V++  +     +    +E A  A   A     K
Sbjct: 1  MANSKSAKKRILVAERNRVRNQAVKTRVKTMAKKVLSTLEVKDVEAAKAALSVAYKEFDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKGI   N ASRK +RL+ ++  ++ S
Sbjct: 61 AVSKGILKKNTASRKKARLAAKVNSLVNS 89


>gi|161485775|ref|NP_705979.3| 30S ribosomal protein S20 [Shigella flexneri 2a str. 301]
 gi|33301638|sp|Q83SR1|RS20_SHIFL RecName: Full=30S ribosomal protein S20
          Length = 87

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +   I  SRRS +R F++  + AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKARKIIASRRSMMRPFIKKGDAAIEAGDKAAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|23099431|ref|NP_692897.1| 30S ribosomal protein S20 [Oceanobacillus iheyensis HTE831]
 gi|59798908|sp|Q8EPW0|RS20_OCEIH RecName: Full=30S ribosomal protein S20
 gi|22777660|dbj|BAC13932.1| 30S ribosomal protein S20 [Oceanobacillus iheyensis HTE831]
          Length = 86

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K +    ++ + N  + S++R+ ++   +A+     + A    + A   I K
Sbjct: 1  MANIKSAIKRVEVNEKKRVSNSKQLSAMRTEVKRVEKAVEANDTDNAKSLFQSASKHIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KGI H NAA+R+ SRL+ ++  +
Sbjct: 61 AAQKGIIHQNAANRQKSRLANKINAL 86


>gi|227503093|ref|ZP_03933142.1| 30S ribosomal protein S20 [Corynebacterium accolens ATCC 49725]
 gi|306836670|ref|ZP_07469635.1| 30S ribosomal protein S20 [Corynebacterium accolens ATCC 49726]
 gi|227076154|gb|EEI14117.1| 30S ribosomal protein S20 [Corynebacterium accolens ATCC 49725]
 gi|304567442|gb|EFM43042.1| 30S ribosomal protein S20 [Corynebacterium accolens ATCC 49726]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NKS RS+VR+ +R    A+  G    A +  R A   + K+ SKG+FH NAA+ K S L+
Sbjct: 21 NKSVRSAVRTEIRKFRAAVEAGDKAAAEKQLRVASRALDKSVSKGVFHRNAAANKKSGLA 80


>gi|209521018|ref|ZP_03269752.1| ribosomal protein S20 [Burkholderia sp. H160]
 gi|209498552|gb|EDZ98673.1| ribosomal protein S20 [Burkholderia sp. H160]
          Length = 92

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + +   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDQAKAAEIFKASSKTIDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+   A
Sbjct: 61 IADKNIIHKNKAARNKSRLAAAIKGLQAPA 90


>gi|226941417|ref|YP_002796491.1| RpsT [Laribacter hongkongensis HLHK9]
 gi|254813098|sp|C1DBS9|RS20_LARHH RecName: Full=30S ribosomal protein S20
 gi|226716344|gb|ACO75482.1| RpsT [Laribacter hongkongensis HLHK9]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N S R++ R+ ++   +A+  G    A      + S++ +
Sbjct: 1  MANSAQARKRARQSLKARAHNASLRTAYRTAVKKVIKAVEAGDKAAAQAQLVTSTSIMDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N ASR+ SRLS  +K +
Sbjct: 61 IADKGVFHKNKASRQKSRLSAAIKAM 86


>gi|149192167|ref|ZP_01870387.1| 30S ribosomal protein S20 [Vibrio shilonii AK1]
 gi|148834007|gb|EDL51024.1| 30S ribosomal protein S20 [Vibrio shilonii AK1]
          Length = 93

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 36/67 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N SRRS +R++M+    AI  G  E AT A +K    +  
Sbjct: 1  MANSKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTIAAIAAGDKEAATSALQKLLQSLTA 60

Query: 61 AKSKGIF 67
           + KG+F
Sbjct: 61 WRLKGLF 67


>gi|161486822|ref|NP_721514.2| 30S ribosomal protein S20 [Streptococcus mutans UA159]
 gi|59798901|sp|Q8DU30|RS20_STRMU RecName: Full=30S ribosomal protein S20
          Length = 78

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 11/59 (18%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          RS++++F  + NE           E  R A S I KAKSKG+ H N ASR  +RL+ +L
Sbjct: 29 RSAIKAFEANPNE-----------ELFRAASSSIDKAKSKGLIHKNKASRDKARLASKL 76


>gi|11467565|ref|NP_043711.1| ribosomal protein S20 [Odontella sinensis]
 gi|1350886|sp|P49507|RR20_ODOSI RecName: Full=30S ribosomal protein S20, chloroplastic
 gi|1185260|emb|CAA91743.1| 30S ribosomal protein S20 [Odontella sinensis]
          Length = 93

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKI-------EEATEACRK 53
          MAN  SA+K I    R  L N+  +SSVR+  +   + +   KI       E+A      
Sbjct: 1  MANNASAEKRILINERNRLQNRFYKSSVRTLTKLYLKDLEVYKISRNPSDKEKAKNRLSL 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
            S+I K   + +FH N A+RK S+L+ +LK
Sbjct: 61 VYSLIDKGSKRNVFHKNTAARKKSKLASQLK 91


>gi|119511557|ref|ZP_01630665.1| 30S ribosomal protein S20 [Nodularia spumigena CCY9414]
 gi|119463792|gb|EAW44721.1| 30S ribosomal protein S20 [Nodularia spumigena CCY9414]
          Length = 110

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITF------GKIEEATEACRKA 54
           +AN  SA K  +   R  L NK+ +S+VR+ M+    A+          +E+  +  R +
Sbjct: 12  VANTKSALKRAQIGERNRLRNKAYKSAVRTLMKKYFSAVDVYAANPNSDLEKEVQ-VRLS 70

Query: 55  ESV--IQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           E+V  I KA  +G+ H N  +RK SRL+++LK +
Sbjct: 71  EAVSKIDKAVKRGVLHPNNGARKKSRLARKLKPL 104


>gi|310829059|ref|YP_003961416.1| hypothetical protein ELI_3494 [Eubacterium limosum KIST612]
 gi|308740793|gb|ADO38453.1| hypothetical protein ELI_3494 [Eubacterium limosum KIST612]
          Length = 88

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 49/86 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  +   +  L NK+ ++++++ ++  + A+  G   +A EA R A   +  
Sbjct: 1  MANIKSAIKRAKTNEKARLRNKAVKTNLKTTIKKFDAAVAEGDQAKAEEAFRLAVKKLDM 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +K + H NAASRK S L++ L G+
Sbjct: 61 AVTKHVIHKNAASRKKSTLARALNGM 86


>gi|269956994|ref|YP_003326783.1| 30S ribosomal protein S20 [Xylanimonas cellulosilytica DSM 15894]
 gi|269305675|gb|ACZ31225.1| ribosomal protein S20 [Xylanimonas cellulosilytica DSM 15894]
          Length = 86

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NK+ +S +++++R A EA+  G  E AT A   A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNKAVKSELKTYVRRAREAVVAGDKEAATTAAAAASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H N A+ + S ++K
Sbjct: 61 AVSKGVIHANQAANRKSAIAK 81


>gi|171464065|ref|YP_001798178.1| ribosomal protein S20 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|226695399|sp|B1XRS9|RS20_POLNS RecName: Full=30S ribosomal protein S20
 gi|171193603|gb|ACB44564.1| ribosomal protein S20 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS +R+ ++   +AI  G    A +     +S I K
Sbjct: 1  MANTVQARKRARQAVKQNEHNSSLRSKLRTSIKAVRKAIEAGDKAAAAKVFAATQSTIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R+ SRLS  +K +
Sbjct: 61 IADKKIAHKNTAARQKSRLSAAIKAM 86


>gi|309751367|gb|ADO81351.1| 30S ribosomal protein S20 [Haemophilus influenzae R2866]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 3  LANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAVGEKSAAEAAFVEMQKVVDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 63 MASKGLIHANKAANHKSKLAAQIKKL 88


>gi|169829287|ref|YP_001699445.1| ribosomal protein S20 [Lysinibacillus sphaericus C3-41]
 gi|226736517|sp|B1HUH0|RS20_LYSSC RecName: Full=30S ribosomal protein S20
 gi|168993775|gb|ACA41315.1| ribosomal protein S20 [Lysinibacillus sphaericus C3-41]
          Length = 82

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +  + N   +S++R+ ++ A  A+     E   E  + A   + K
Sbjct: 1  MPNIKSAIKRVKVNEKANIANSQAKSAMRTTVKKAENAVAEN-AENKQELLQAAFKSLDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKR 82
          A SKG+ H NAA+RK SRL+K+
Sbjct: 60 AASKGLIHKNAAARKKSRLAKK 81


>gi|118474807|ref|YP_892836.1| 30S ribosomal protein S20 [Campylobacter fetus subsp. fetus
          82-40]
 gi|261886266|ref|ZP_06010305.1| 30S ribosomal protein S20 [Campylobacter fetus subsp. venerealis
          str. Azul-94]
 gi|166223921|sp|A0RRK3|RS20_CAMFF RecName: Full=30S ribosomal protein S20
 gi|118414033|gb|ABK82453.1| ribosomal protein S20 [Campylobacter fetus subsp. fetus 82-40]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +RT  N+  R+ +++  +    A+  G  + A  A + A      
Sbjct: 1  MANHKSAEKRARQTIKRTERNRFYRTRLKNLTKAVRVAVASGDKDAALVALKDANKNFHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            SKG      ASRKVSRL+K
Sbjct: 61 FVSKGFLKKETASRKVSRLAK 81


>gi|221632854|ref|YP_002522076.1| 30S ribosomal protein-like protein [Thermomicrobium roseum DSM
          5159]
 gi|254813071|sp|B9KZD4|RS20_THERP RecName: Full=30S ribosomal protein S20
 gi|221155777|gb|ACM04904.1| 30S ribosomal protein-like protein [Thermomicrobium roseum DSM
          5159]
          Length = 99

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%)

Query: 26 SSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKG 85
          S  R+F++ A + +  G +E A      A S + +A +KG  H N A+R+ SRL KR   
Sbjct: 26 SMARTFIKKARKLMEAGDLEAAARVIGDAISTLDRAAAKGAIHKNNAARRKSRLMKRFNA 85

Query: 86 IL 87
          ++
Sbjct: 86 LV 87


>gi|295677499|ref|YP_003606023.1| ribosomal protein S20 [Burkholderia sp. CCGE1002]
 gi|295437342|gb|ADG16512.1| ribosomal protein S20 [Burkholderia sp. CCGE1002]
          Length = 92

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + +   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDQAKAAEIFKASSKTIDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+   A
Sbjct: 61 IADKNIIHKNKAARHKSRLAAAIKGLQAPA 90


>gi|269127469|ref|YP_003300839.1| 30S ribosomal protein S20 [Thermomonospora curvata DSM 43183]
 gi|268312427|gb|ACY98801.1| ribosomal protein S20 [Thermomonospora curvata DSM 43183]
          Length = 90

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 49/87 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  ++  +R L NK+ +S +++ +R   EA+  G +E A  A R A   + K
Sbjct: 1  MANIKSQIKRNKQNEKRRLRNKAVKSELKTAIRRFREALEAGDVEAAIAAQRHAARKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A SKG+ H N A+ + S ++KR   +L
Sbjct: 61 AASKGVIHKNQAANRKSAIAKRAAALL 87


>gi|317054966|ref|YP_004103433.1| 30S ribosomal protein S20 [Ruminococcus albus 7]
 gi|315447235|gb|ADU20799.1| ribosomal protein S20 [Ruminococcus albus 7]
          Length = 83

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK ++ I ++TL NK+ +S +++ ++ A+ A+     ++  +  R A   +  
Sbjct: 1  MPNIKSAKKRVKVIEKKTLRNKAIKSDLKTALKKADAAVANNAADK-EQVVRTAIKKVDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +KGI H N A+RK S+L+K+L
Sbjct: 60 ACTKGILHKNNAARKKSQLAKKL 82


>gi|87301296|ref|ZP_01084137.1| 30S ribosomal protein S20 [Synechococcus sp. WH 5701]
 gi|87284264|gb|EAQ76217.1| 30S ribosomal protein S20 [Synechococcus sp. WH 5701]
          Length = 101

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  S+KK I    R  L N++ +S+VR+ M+    A+T    E   +       +   
Sbjct: 1  MANNKSSKKRILIAERNWLQNRTYKSAVRTLMKRCFAAVTVYSQEPGEDNKTAVQASLNA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
          A S I KA   G+ H N  + + SRLS  +K
Sbjct: 61 AFSKIDKAVKVGVIHRNTGANQKSRLSTAVK 91


>gi|229013542|ref|ZP_04170676.1| 30S ribosomal protein S20 [Bacillus mycoides DSM 2048]
 gi|229062020|ref|ZP_04199346.1| 30S ribosomal protein S20 [Bacillus cereus AH603]
 gi|229135147|ref|ZP_04263948.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-ST196]
 gi|229169070|ref|ZP_04296786.1| 30S ribosomal protein S20 [Bacillus cereus AH621]
 gi|228614479|gb|EEK71588.1| 30S ribosomal protein S20 [Bacillus cereus AH621]
 gi|228648324|gb|EEL04358.1| 30S ribosomal protein S20 [Bacillus cereus BDRD-ST196]
 gi|228717329|gb|EEL69002.1| 30S ribosomal protein S20 [Bacillus cereus AH603]
 gi|228747779|gb|EEL97648.1| 30S ribosomal protein S20 [Bacillus mycoides DSM 2048]
          Length = 58

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          +R+ ++     +T   +E A EA + A   + KA  KG+ H NAA+R+ SRL+K++
Sbjct: 1  MRTAVKTVETLVTNNDLENAKEAFKTASKKLDKAARKGLIHQNAAARQKSRLAKQV 56


>gi|237729318|ref|ZP_04559799.1| 30S ribosomal protein S20 [Citrobacter sp. 30_2]
 gi|283835084|ref|ZP_06354825.1| ribosomal protein S20 [Citrobacter youngae ATCC 29220]
 gi|226909047|gb|EEH94965.1| 30S ribosomal protein S20 [Citrobacter sp. 30_2]
 gi|291069377|gb|EFE07486.1| ribosomal protein S20 [Citrobacter youngae ATCC 29220]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKATALKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|206580471|ref|YP_002240528.1| ribosomal protein S20 [Klebsiella pneumoniae 342]
 gi|238893005|ref|YP_002917739.1| 30S ribosomal protein S20 [Klebsiella pneumoniae NTUH-K2044]
 gi|283783802|ref|YP_003363667.1| 30S ribosomal protein S20 [Citrobacter rodentium ICC168]
 gi|290512631|ref|ZP_06551997.1| 30S ribosomal protein S20 [Klebsiella sp. 1_1_55]
 gi|226736507|sp|B5Y237|RS20_KLEP3 RecName: Full=30S ribosomal protein S20
 gi|206569529|gb|ACI11305.1| ribosomal protein S20 [Klebsiella pneumoniae 342]
 gi|238545321|dbj|BAH61672.1| 30S ribosomal protein S20 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|238774008|dbj|BAH66505.1| 30S ribosomal protein S20 [Klebsiella pneumoniae NTUH-K2044]
 gi|282947256|emb|CBG86801.1| 30S ribosomal protein S20 [Citrobacter rodentium ICC168]
 gi|289774972|gb|EFD82974.1| 30S ribosomal protein S20 [Klebsiella sp. 1_1_55]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|84496874|ref|ZP_00995728.1| putative ribosomal protein S20 [Janibacter sp. HTCC2649]
 gi|84383642|gb|EAP99523.1| putative ribosomal protein S20 [Janibacter sp. HTCC2649]
          Length = 86

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+     T  NK+ +S VR+  R   +    GK++EA +A + A + + K
Sbjct: 1  MANIKSQLKRIKTNKVATERNKAVKSDVRTAARKFRDLAEAGKVDEAKDALKVASTKLDK 60

Query: 61 AKSKGIFHGN 70
          A SKG+ H N
Sbjct: 61 AVSKGVLHKN 70


>gi|291302913|ref|YP_003514191.1| 30S ribosomal protein S20 [Stackebrandtia nassauensis DSM 44728]
 gi|290572133|gb|ADD45098.1| ribosomal protein S20 [Stackebrandtia nassauensis DSM 44728]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  ++  +  L NK+ +S +++ +R  +     G +E AT   R A   + K
Sbjct: 1  MANIKSQIKRNKQNEKARLRNKAVKSELKTQIRKFHSLAETGDLEAATTQQRVASQKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S L+K+L+ +
Sbjct: 61 AVSKGVIHKNQAANRKSALAKKLQNV 86


>gi|148240400|ref|YP_001225787.1| 30S ribosomal protein S20 [Synechococcus sp. WH 7803]
 gi|166223996|sp|A5GNH5|RS20_SYNPW RecName: Full=30S ribosomal protein S20
 gi|147848939|emb|CAK24490.1| 30S ribosomal protein S20 [Synechococcus sp. WH 7803]
          Length = 102

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMR---HANEAITFGKIEEATEACR----K 53
          MAN  S+KK +    R  L NK+ +SS+R+ M+    A EA      +EA  + +     
Sbjct: 1  MANNKSSKKRVEIAERNRLQNKAYKSSMRTLMKRCFSACEAYNATPGDEAKTSVQASMNA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA  +G+ H NA + + +RLS  +K  +  A
Sbjct: 61 AFSKIDKAVKRGVLHRNAGAHQKARLSVAVKKAIDPA 97


>gi|317046853|ref|YP_004114501.1| 30S ribosomal protein S20 [Pantoea sp. At-9b]
 gi|316948470|gb|ADU67945.1| ribosomal protein S20 [Pantoea sp. At-9b]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N S RS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASNRSMMRTFIKKVYAAIATGDKAAAQNAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|297537728|ref|YP_003673497.1| 30S ribosomal protein S20 [Methylotenera sp. 301]
 gi|297257075|gb|ADI28920.1| ribosomal protein S20 [Methylotenera sp. 301]
          Length = 111

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS++R+ ++   +A+  G    AT    +  SVI +
Sbjct: 1  MANTAQARKRARQAVKQRAHNASLRSTLRTAIKKIIKAVEAGDKVAATAVYSENVSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N ASR  SRL+  +K +
Sbjct: 61 IADKNIIHKNKASRHKSRLNAAIKAM 86


>gi|166368189|ref|YP_001660462.1| 30S ribosomal protein S20 [Microcystis aeruginosa NIES-843]
 gi|189044870|sp|B0JGK4|RS20_MICAN RecName: Full=30S ribosomal protein S20
 gi|166090562|dbj|BAG05270.1| 30S ribosomal protein S20 [Microcystis aeruginosa NIES-843]
          Length = 97

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 7/93 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAIT-FGK------IEEATEACRK 53
          MAN  SA K ++   R  L NK+ +S+VR+ ++    A++ +G       +E A +A  +
Sbjct: 1  MANTKSALKRVQISERNRLRNKAYKSAVRTLIKKCLVAVSAYGANPSPEGLESAQQALSE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          A S I KA  + + H N  +RK + L+K L+ +
Sbjct: 61 AYSKIDKAVKRNVLHRNNGARKKAGLAKALQKV 93


>gi|257126548|ref|YP_003164662.1| ribosomal protein S20 [Leptotrichia buccalis C-1013-b]
 gi|257050487|gb|ACV39671.1| ribosomal protein S20 [Leptotrichia buccalis C-1013-b]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  S+KK +    R    N++ RS  ++F++    A+    ++EA  A   A   + K
Sbjct: 1  MAHSKSSKKRVFIGERNAARNQAIRSRTKTFVKKVLAAVEAKNVDEAKSALSAAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+   N ASRK SRL+ ++  +
Sbjct: 61 AVTKGVLKKNTASRKKSRLTLKVNAL 86


>gi|218437734|ref|YP_002376063.1| 30S ribosomal protein S20 [Cyanothece sp. PCC 7424]
 gi|226736479|sp|B7KG02|RS20_CYAP7 RecName: Full=30S ribosomal protein S20
 gi|218170462|gb|ACK69195.1| ribosomal protein S20 [Cyanothece sp. PCC 7424]
          Length = 97

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKI---EEATEACRKAESV 57
          MAN  SA K I+   R  L NKS +S+V++ M+    A+   K    EEA +A  +A S 
Sbjct: 1  MANIKSAIKRIQIAERNRLRNKSYKSAVKTLMKKYYAAVEDYKANPSEEAKKAVDQAMSA 60

Query: 58 ----IQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
              I KA    I H N  +RK S+L+  LK + T++
Sbjct: 61 AYSKIDKAVKCRILHRNNGARKKSQLANALKQVTTAS 97


>gi|71908648|ref|YP_286235.1| 30S ribosomal protein S20 [Dechloromonas aromatica RCB]
 gi|115305679|sp|Q47BL6|RS20_DECAR RecName: Full=30S ribosomal protein S20
 gi|71848269|gb|AAZ47765.1| SSU ribosomal protein S20P [Dechloromonas aromatica RCB]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   +   N S RS++R+ ++   +AI  G    A    +++ +V+ +
Sbjct: 1  MANSAQARKRARQADGQRSHNASLRSTLRTAIKRVRQAIEAGDKAAAQGVFQQSVAVLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N ASR  SRLS ++K +
Sbjct: 61 IADKKIVHKNKASRTKSRLSAQIKAL 86


>gi|94311836|ref|YP_585046.1| 30S ribosomal protein S20 [Cupriavidus metallidurans CH34]
 gi|118573832|sp|Q1LJ99|RS20_RALME RecName: Full=30S ribosomal protein S20
 gi|93355688|gb|ABF09777.1| 30S ribosomal subunit protein S20 [Cupriavidus metallidurans
          CH34]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+       N S RS +R+ ++   +AI  G    A E  ++++ VI  
Sbjct: 1  MANSAQARKRARQAVAANAHNSSLRSRLRTAVKAVRKAIDAGDKAAAAEIYKQSQVVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAIKAM 86


>gi|293400534|ref|ZP_06644679.1| ribosomal protein S20 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305560|gb|EFE46804.1| ribosomal protein S20 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M    S KK ++   +R L   +++S++++ +++   A+     E A  A   A S + K
Sbjct: 1  MPQIQSQKKRVKTNNKRNLAVNAQKSALKTAIKNVLSAVEANDKEAAVAALNTANSKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI H N A R+ SRL+K +  I
Sbjct: 61 AVAKGIQHRNYAVRQKSRLAKAVNSI 86


>gi|229086893|ref|ZP_04219052.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-44]
 gi|228696403|gb|EEL49229.1| 30S ribosomal protein S20 [Bacillus cereus Rock3-44]
          Length = 58

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 39 ITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          +T   +E A EA + A   + KA  KG+ H NAA+R+ SRL+K++
Sbjct: 12 VTNNDLENAKEAFKTASKKLDKAARKGLIHQNAAARQKSRLAKQV 56


>gi|161523925|ref|YP_001578937.1| 30S ribosomal protein S20 [Burkholderia multivorans ATCC 17616]
 gi|167585663|ref|ZP_02378051.1| ribosomal protein S20 [Burkholderia ubonensis Bu]
 gi|189351314|ref|YP_001946942.1| 30S ribosomal protein S20 [Burkholderia multivorans ATCC 17616]
 gi|221199212|ref|ZP_03572256.1| 30S ribosomal protein S20 [Burkholderia multivorans CGD2M]
 gi|221206591|ref|ZP_03579603.1| 30S ribosomal protein S20 [Burkholderia multivorans CGD2]
 gi|221211437|ref|ZP_03584416.1| 30S ribosomal protein S20 [Burkholderia multivorans CGD1]
 gi|226735308|sp|A9AGJ8|RS20_BURM1 RecName: Full=30S ribosomal protein S20
 gi|160341354|gb|ABX14440.1| ribosomal protein S20 [Burkholderia multivorans ATCC 17616]
 gi|189335336|dbj|BAG44406.1| small subunit ribosomal protein S20 [Burkholderia multivorans
          ATCC 17616]
 gi|221168798|gb|EEE01266.1| 30S ribosomal protein S20 [Burkholderia multivorans CGD1]
 gi|221173246|gb|EEE05681.1| 30S ribosomal protein S20 [Burkholderia multivorans CGD2]
 gi|221180497|gb|EEE12900.1| 30S ribosomal protein S20 [Burkholderia multivorans CGD2M]
 gi|325522463|gb|EGD01037.1| 30S ribosomal protein S20 [Burkholderia sp. TJI49]
          Length = 90

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +A+  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAVDAGDQAKAAELFKAAVKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+  +A
Sbjct: 61 IADKKIVHKNKAARSKSRLAAAVKGLQAAA 90


>gi|16759037|ref|NP_454654.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16763433|ref|NP_459048.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|29140587|ref|NP_803929.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56412316|ref|YP_149391.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62178607|ref|YP_215024.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|161504826|ref|YP_001571938.1| 30S ribosomal protein S20 [Salmonella enterica subsp. arizonae
          serovar 62:z4,z23:-- str. RSK2980]
 gi|194444108|ref|YP_002039273.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194448125|ref|YP_002044010.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194470216|ref|ZP_03076200.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194737585|ref|YP_002113055.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195873723|ref|ZP_02698329.2| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197247824|ref|YP_002145024.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197264280|ref|ZP_03164354.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197300649|ref|ZP_02659844.2| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|197361253|ref|YP_002140888.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|198242992|ref|YP_002213997.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|200388181|ref|ZP_03214793.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204926976|ref|ZP_03218178.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205357532|ref|ZP_02570996.2| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|205359228|ref|ZP_02668498.2| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|205360532|ref|ZP_02684265.2| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|207855559|ref|YP_002242210.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|224581880|ref|YP_002635678.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|289826110|ref|ZP_06545222.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-3139]
 gi|61236725|sp|P0A2B1|RS20_SALTY RecName: Full=30S ribosomal protein S20
 gi|61236729|sp|P0A2B2|RS20_SALTI RecName: Full=30S ribosomal protein S20
 gi|62510990|sp|Q5PDM2|RS20_SALPA RecName: Full=30S ribosomal protein S20
 gi|75484930|sp|Q57TL8|RS20_SALCH RecName: Full=30S ribosomal protein S20
 gi|189044880|sp|A9MR48|RS20_SALAR RecName: Full=30S ribosomal protein S20
 gi|226695411|sp|B5F721|RS20_SALA4 RecName: Full=30S ribosomal protein S20
 gi|226695412|sp|B5FHD7|RS20_SALDC RecName: Full=30S ribosomal protein S20
 gi|226695413|sp|B5R0X8|RS20_SALEP RecName: Full=30S ribosomal protein S20
 gi|226695415|sp|B4TIE3|RS20_SALHS RecName: Full=30S ribosomal protein S20
 gi|226695416|sp|B4T6G9|RS20_SALNS RecName: Full=30S ribosomal protein S20
 gi|226695417|sp|B5BLK7|RS20_SALPK RecName: Full=30S ribosomal protein S20
 gi|226695418|sp|B4TWN4|RS20_SALSV RecName: Full=30S ribosomal protein S20
 gi|254813061|sp|C0Q4I2|RS20_SALPC RecName: Full=30S ribosomal protein S20
 gi|25294868|pir||AF0507 30S ribosomal protein S20 [imported] - Salmonella enterica subsp.
          enterica serovar Typhi (strain CT18)
 gi|16418538|gb|AAL19007.1| 30S ribosomal subunit protein S20 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|16501327|emb|CAD01198.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhi]
 gi|29136211|gb|AAO67778.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56126573|gb|AAV76079.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62126240|gb|AAX63943.1| 30S ribosomal subunit protein S20 [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|160866173|gb|ABX22796.1| hypothetical protein SARI_02950 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
 gi|194402771|gb|ACF62993.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194406429|gb|ACF66648.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194456580|gb|EDX45419.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194713087|gb|ACF92308.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195633038|gb|EDX51492.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197092728|emb|CAR58151.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|197211527|gb|ACH48924.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197242535|gb|EDY25155.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197291990|gb|EDY31340.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|197937508|gb|ACH74841.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|199605279|gb|EDZ03824.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204323641|gb|EDZ08836.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205331533|gb|EDZ18297.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|205337409|gb|EDZ24173.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|205348678|gb|EDZ35309.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|206707362|emb|CAR31634.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|224466407|gb|ACN44237.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|261245277|emb|CBG23062.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. D23580]
 gi|267991704|gb|ACY86589.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|301156675|emb|CBW16145.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. SL1344]
 gi|320089075|emb|CBY98831.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|322713058|gb|EFZ04629.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
 gi|323128361|gb|ADX15791.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|323216639|gb|EGA01364.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB101509-0077]
 gi|323228724|gb|EGA12853.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB111609-0052]
 gi|323242115|gb|EGA26144.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315731156]
 gi|323263846|gb|EGA47367.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008284]
 gi|332986995|gb|AEF05978.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|107023488|ref|YP_621815.1| 30S ribosomal protein S20 [Burkholderia cenocepacia AU 1054]
 gi|115352651|ref|YP_774490.1| 30S ribosomal protein S20 [Burkholderia ambifaria AMMD]
 gi|116690571|ref|YP_836194.1| 30S ribosomal protein S20 [Burkholderia cenocepacia HI2424]
 gi|134296736|ref|YP_001120471.1| 30S ribosomal protein S20 [Burkholderia vietnamiensis G4]
 gi|170698609|ref|ZP_02889677.1| ribosomal protein S20 [Burkholderia ambifaria IOP40-10]
 gi|170733911|ref|YP_001765858.1| 30S ribosomal protein S20 [Burkholderia cenocepacia MC0-3]
 gi|172061512|ref|YP_001809164.1| 30S ribosomal protein S20 [Burkholderia ambifaria MC40-6]
 gi|206561102|ref|YP_002231867.1| 30S ribosomal protein S20 [Burkholderia cenocepacia J2315]
 gi|254251593|ref|ZP_04944911.1| Ribosomal protein S20p [Burkholderia dolosa AUO158]
 gi|118573808|sp|Q1BU63|RS20_BURCA RecName: Full=30S ribosomal protein S20
 gi|122322388|sp|Q0BCG7|RS20_BURCM RecName: Full=30S ribosomal protein S20
 gi|166223911|sp|A0K9X4|RS20_BURCH RecName: Full=30S ribosomal protein S20
 gi|166223917|sp|A4JH83|RS20_BURVG RecName: Full=30S ribosomal protein S20
 gi|226735305|sp|B1YVE4|RS20_BURA4 RecName: Full=30S ribosomal protein S20
 gi|226735306|sp|B1JXG1|RS20_BURCC RecName: Full=30S ribosomal protein S20
 gi|226735307|sp|B4E9G4|RS20_BURCJ RecName: Full=30S ribosomal protein S20
 gi|105893677|gb|ABF76842.1| SSU ribosomal protein S20P [Burkholderia cenocepacia AU 1054]
 gi|115282639|gb|ABI88156.1| SSU ribosomal protein S20P [Burkholderia ambifaria AMMD]
 gi|116648660|gb|ABK09301.1| SSU ribosomal protein S20P [Burkholderia cenocepacia HI2424]
 gi|124894202|gb|EAY68082.1| Ribosomal protein S20p [Burkholderia dolosa AUO158]
 gi|134139893|gb|ABO55636.1| SSU ribosomal protein S20P [Burkholderia vietnamiensis G4]
 gi|169817153|gb|ACA91736.1| ribosomal protein S20 [Burkholderia cenocepacia MC0-3]
 gi|170136462|gb|EDT04722.1| ribosomal protein S20 [Burkholderia ambifaria IOP40-10]
 gi|171994029|gb|ACB64948.1| ribosomal protein S20 [Burkholderia ambifaria MC40-6]
 gi|198037144|emb|CAR53065.1| 30S ribosomal protein S20 [Burkholderia cenocepacia J2315]
          Length = 90

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +A+  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKSVRKAVEAGDQAKAAELFKAAVKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+  +A
Sbjct: 61 IADKKIVHKNKAARSKSRLAAAVKGLQAAA 90


>gi|293391729|ref|ZP_06636063.1| 30S ribosomal protein S20 [Aggregatibacter actinomycetemcomitans
          D7S-1]
 gi|290952263|gb|EFE02382.1| 30S ribosomal protein S20 [Aggregatibacter actinomycetemcomitans
          D7S-1]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 1  MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKAAAEVAFVEMQKVVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 61 MASKGLIHANKAANHKSKLAAQIKKL 86


>gi|146310246|ref|YP_001175320.1| 30S ribosomal protein S20 [Enterobacter sp. 638]
 gi|167011213|sp|A4W6D9|RS20_ENT38 RecName: Full=30S ribosomal protein S20
 gi|145317122|gb|ABP59269.1| SSU ribosomal protein S20P [Enterobacter sp. 638]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A  A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQNAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|328953431|ref|YP_004370765.1| 30S ribosomal protein S20 [Desulfobacca acetoxidans DSM 11109]
 gi|328453755|gb|AEB09584.1| 30S ribosomal protein S20 [Desulfobacca acetoxidans DSM 11109]
          Length = 90

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 43/70 (61%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SR++ V++ ++    A++  + E+A  A +KA  VIQ+  ++G  H   A+RK+SRL+
Sbjct: 21 NLSRKTRVKNLVKAVRTAVSQNQPEQAQAALQKAAPVIQRVAAQGTMHWKTAARKISRLT 80

Query: 81 KRLKGILTSA 90
          + +  + + A
Sbjct: 81 RHINALSSDA 90


>gi|13633921|sp|Q9CKG0|RS20_PASMU RecName: Full=30S ribosomal protein S20
 gi|12722063|gb|AAK03743.1| RpS20 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N S+RS +R++++    A+  G    A +A  + + V+ +
Sbjct: 3  LANIKSAKKRAIQSEKRRQHNASQRSMMRTYIKKVYAAVAAGDKSVAEKAFVEMQKVVDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   + LS ++K +
Sbjct: 63 MASKGLIHANKAANHKANLSAQIKKL 88


>gi|313888862|ref|ZP_07822522.1| ribosomal protein S20 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845035|gb|EFR32436.1| ribosomal protein S20 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K I    R +  NK  R+ +++ +++   A+   +I++A E    A+  ++K
Sbjct: 1  MANIKSAIKRIDVARRNSEQNKPIRTEMKNAVKNFRAALNEDRIDDAKELLIVADKKLKK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A +K I H N ASRK+SRL+K L
Sbjct: 61 AANKNIIHKNQASRKLSRLAKEL 83


>gi|33863776|ref|NP_895336.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9313]
 gi|59798837|sp|Q7TUR7|RS20_PROMM RecName: Full=30S ribosomal protein S20
 gi|33635359|emb|CAE21684.1| 30S Ribosomal protein S20 [Prochlorococcus marinus str. MIT 9313]
          Length = 100

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIE--EATEACRKAE--- 55
          MAN  S+KK ++   R  L NKS +S++R+ M+    A +    +  E  +A  KA    
Sbjct: 1  MANNKSSKKRVQIAERNRLENKSYKSAMRTLMKRCFSACSHYSQQPGETAKANVKASIDS 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            S I KA  +G+ H N A+ + SRLS  +K  +  A
Sbjct: 61 AFSKIDKAVKRGVLHRNTAAHQKSRLSAAVKQAIEPA 97


>gi|257868069|ref|ZP_05647722.1| ribosomal protein S20 [Enterococcus casseliflavus EC30]
 gi|257874399|ref|ZP_05654052.1| ribosomal protein S20 [Enterococcus casseliflavus EC10]
 gi|257876958|ref|ZP_05656611.1| ribosomal protein S20 [Enterococcus casseliflavus EC20]
 gi|325570542|ref|ZP_08146268.1| 30S ribosomal protein S20 [Enterococcus casseliflavus ATCC 12755]
 gi|257802152|gb|EEV31055.1| ribosomal protein S20 [Enterococcus casseliflavus EC30]
 gi|257808563|gb|EEV37385.1| ribosomal protein S20 [Enterococcus casseliflavus EC10]
 gi|257811124|gb|EEV39944.1| ribosomal protein S20 [Enterococcus casseliflavus EC20]
 gi|325156388|gb|EGC68568.1| 30S ribosomal protein S20 [Enterococcus casseliflavus ATCC 12755]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K +R        N S+ S++R+ ++  ++A+  G  +      + A   I  
Sbjct: 1  MPNIESAIKRVRTSEAANAKNSSQVSTMRTAIKKFDQAVEAG-ADNVDALYKDAVKAIDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A++KG+ H N ASR  SRLSK++
Sbjct: 60 AETKGLIHKNKASRDKSRLSKKI 82


>gi|298528171|ref|ZP_07015575.1| ribosomal protein S20 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511823|gb|EFI35725.1| ribosomal protein S20 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 90

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ ++ +++  +  ++A+     ++A+ A +KA S + KA  K + H   A+RK+SRL+
Sbjct: 21 NKAVKTRIKNVTKAVHQAVNQQDADQASRAIQKAASTLDKAAQKRVIHWKKAARKISRLN 80

Query: 81 KRLKGILTS 89
           R+   L S
Sbjct: 81 -RMVNTLQS 88


>gi|209522758|ref|ZP_03271316.1| ribosomal protein S20 [Arthrospira maxima CS-328]
 gi|209496807|gb|EDZ97104.1| ribosomal protein S20 [Arthrospira maxima CS-328]
          Length = 124

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
           MAN  SA K ++   R  L N++  S+VR+ M+    A+         EA ++ +     
Sbjct: 20  MANIKSAIKRVQIAERNRLRNRTYNSAVRTLMKKYFAAVEQYAANPTDEALQEVQQRMSA 79

Query: 56  --SVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
             S I KA   G+ H N A+RK SRL++ LK
Sbjct: 80  TTSKIDKAVKVGVLHRNNAARKKSRLARFLK 110


>gi|320104405|ref|YP_004179996.1| 30S ribosomal protein S20 [Isosphaera pallida ATCC 43644]
 gi|319751687|gb|ADV63447.1| ribosomal protein S20 [Isosphaera pallida ATCC 43644]
          Length = 95

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 45/81 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K +++  +R + N+  +  +R++ +    A+  G+ E+A    R   + I K
Sbjct: 1  MPNTHSAIKRLKQSQKRRMHNRIAKKIIRTYTKRTLAAVAAGEFEKAEADFRFTIAKIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A ++ I H N A+R+ SRL++
Sbjct: 61 AGARRILHPNTAARRKSRLTR 81


>gi|237749098|ref|ZP_04579578.1| predicted protein [Oxalobacter formigenes OXCC13]
 gi|229380460|gb|EEO30551.1| predicted protein [Oxalobacter formigenes OXCC13]
          Length = 90

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N S+RS++R+ ++ A +AI  G  E A        SVI +
Sbjct: 1  MANTAQARKRARQAVKLNAHNSSQRSALRTAIKTAQKAIAAGDKEAAASVFNNTVSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
             K   H N A+R  SRL
Sbjct: 61 IADKKRIHKNKAARHKSRL 79


>gi|116330124|ref|YP_799842.1| 30S ribosomal protein S20 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
 gi|122282108|sp|Q04VI6|RS20_LEPBJ RecName: Full=30S ribosomal protein S20
 gi|116123813|gb|ABJ75084.1| 30S Ribosomal protein S20 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
          Length = 90

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S++K IR+  RR   N   RS +R+  +   +AI     + A     +  S + K
Sbjct: 1  MANIKSSEKDIRRTKRRNAANSQNRSRLRTQAKKILKAIKEKDPKAAMALFIEYTSFLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A    + H   A RK SR++KRL  +  +A
Sbjct: 61 AAKTNLIHSKNADRKKSRMAKRLNAVFAAA 90


>gi|171322129|ref|ZP_02910991.1| ribosomal protein S20 [Burkholderia ambifaria MEX-5]
 gi|171092569|gb|EDT37883.1| ribosomal protein S20 [Burkholderia ambifaria MEX-5]
          Length = 90

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +A+  G   +A E  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTSIKSVRKAVEAGDQAKAAELFKAAVKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+  +A
Sbjct: 61 IADKKIVHKNKAARSKSRLAAAVKGLQAAA 90


>gi|284030323|ref|YP_003380254.1| 30S ribosomal protein S20 [Kribbella flavida DSM 17836]
 gi|283809616|gb|ADB31455.1| ribosomal protein S20 [Kribbella flavida DSM 17836]
          Length = 86

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGN-AASRKVS 77
          L NKS +S++++ +R   EA   G   +A E  R A  ++ KA SKG+ H N AA+RK S
Sbjct: 19 LRNKSVKSTLKTAVRRFREAADAGDSAKAQEQARVAARLLDKAASKGVIHANQAANRKSS 78


>gi|15799705|ref|NP_285717.1| 30S ribosomal protein S20 [Escherichia coli O157:H7 EDL933]
 gi|15829280|ref|NP_308053.1| 30S ribosomal protein S20 [Escherichia coli O157:H7 str. Sakai]
 gi|16128017|ref|NP_414564.1| 30S ribosomal subunit protein S20 [Escherichia coli str. K-12
          substr. MG1655]
 gi|26245944|ref|NP_751983.1| 30S ribosomal protein S20 [Escherichia coli CFT073]
 gi|74310641|ref|YP_309060.1| 30S ribosomal protein S20 [Shigella sonnei Ss046]
 gi|82542639|ref|YP_406586.1| 30S ribosomal protein S20 [Shigella boydii Sb227]
 gi|82775425|ref|YP_401772.1| 30S ribosomal protein S20 [Shigella dysenteriae Sd197]
 gi|89106907|ref|AP_000687.1| 30S ribosomal subunit protein S20 [Escherichia coli str. K-12
          substr. W3110]
 gi|91209080|ref|YP_539066.1| 30S ribosomal protein S20 [Escherichia coli UTI89]
 gi|110640235|ref|YP_667963.1| 30S ribosomal protein S20 [Escherichia coli 536]
 gi|157156490|ref|YP_001461191.1| 30S ribosomal protein S20 [Escherichia coli E24377A]
 gi|157159490|ref|YP_001456808.1| 30S ribosomal protein S20 [Escherichia coli HS]
 gi|161486555|ref|NP_835762.2| 30S ribosomal protein S20 [Shigella flexneri 2a str. 2457T]
 gi|168762784|ref|ZP_02787791.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4501]
 gi|168781720|ref|ZP_02806727.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4076]
 gi|168785074|ref|ZP_02810081.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC869]
 gi|170021617|ref|YP_001726571.1| 30S ribosomal protein S20 [Escherichia coli ATCC 8739]
 gi|170079686|ref|YP_001729006.1| 30S ribosomal subunit protein S20 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170683345|ref|YP_001742139.1| 30S ribosomal protein S20 [Escherichia coli SMS-3-5]
 gi|170768548|ref|ZP_02903001.1| ribosomal protein S20 [Escherichia albertii TW07627]
 gi|187731624|ref|YP_001878847.1| 30S ribosomal protein S20 [Shigella boydii CDC 3083-94]
 gi|188493796|ref|ZP_03001066.1| ribosomal protein S20 [Escherichia coli 53638]
 gi|189402846|ref|ZP_02791718.2| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4486]
 gi|191168887|ref|ZP_03030658.1| ribosomal protein S20 [Escherichia coli B7A]
 gi|208812441|ref|ZP_03253770.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4045]
 gi|208819035|ref|ZP_03259355.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4042]
 gi|209399727|ref|YP_002268630.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4115]
 gi|209917212|ref|YP_002291296.1| 30S ribosomal protein S20 [Escherichia coli SE11]
 gi|215485184|ref|YP_002327615.1| 30S ribosomal protein S20 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217325102|ref|ZP_03441186.1| ribosomal protein S20 [Escherichia coli O157:H7 str. TW14588]
 gi|218547456|ref|YP_002381247.1| 30S ribosomal protein S20 [Escherichia fergusonii ATCC 35469]
 gi|218552607|ref|YP_002385520.1| 30S ribosomal protein S20 [Escherichia coli IAI1]
 gi|218556960|ref|YP_002389873.1| 30S ribosomal protein S20 [Escherichia coli S88]
 gi|218687897|ref|YP_002396109.1| 30S ribosomal protein S20 [Escherichia coli ED1a]
 gi|218693494|ref|YP_002401161.1| 30S ribosomal protein S20 [Escherichia coli 55989]
 gi|218698444|ref|YP_002406073.1| 30S ribosomal protein S20 [Escherichia coli IAI39]
 gi|218703283|ref|YP_002410802.1| 30S ribosomal protein S20 [Escherichia coli UMN026]
 gi|227885083|ref|ZP_04002888.1| 30S ribosomal protein S20 [Escherichia coli 83972]
 gi|237704162|ref|ZP_04534643.1| 30S ribosomal subunit protein S20 [Escherichia sp. 3_2_53FAA]
 gi|238899428|ref|YP_002925224.1| 30S ribosomal subunit protein S20 [Escherichia coli BW2952]
 gi|253774945|ref|YP_003037776.1| 30S ribosomal protein S20 [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|254037438|ref|ZP_04871515.1| ribosomal protein S20 [Escherichia sp. 1_1_43]
 gi|254160149|ref|YP_003043257.1| 30S ribosomal protein S20 [Escherichia coli B str. REL606]
 gi|254791158|ref|YP_003075995.1| 30S ribosomal protein S20 [Escherichia coli O157:H7 str. TW14359]
 gi|256020136|ref|ZP_05434001.1| 30S ribosomal protein S20 [Shigella sp. D9]
 gi|260842260|ref|YP_003220038.1| 30S ribosomal subunit protein S20 [Escherichia coli O103:H2 str.
          12009]
 gi|260853233|ref|YP_003227124.1| 30S ribosomal subunit protein S20 [Escherichia coli O26:H11 str.
          11368]
 gi|260866173|ref|YP_003232575.1| 30S ribosomal subunit protein S20 [Escherichia coli O111:H- str.
          11128]
 gi|261226782|ref|ZP_05941063.1| 30S ribosomal subunit protein S20 [Escherichia coli O157:H7 str.
          FRIK2000]
 gi|291280846|ref|YP_003497664.1| 30S ribosomal protein S20 [Escherichia coli O55:H7 str. CB9615]
 gi|293403096|ref|ZP_06647193.1| rpsT [Escherichia coli FVEC1412]
 gi|293408115|ref|ZP_06651955.1| 30S ribosomal protein S20 [Escherichia coli B354]
 gi|293417899|ref|ZP_06660521.1| 30S ribosomal protein S20 [Escherichia coli B185]
 gi|293476686|ref|ZP_06665094.1| 30S ribosomal protein S20 [Escherichia coli B088]
 gi|298378623|ref|ZP_06988507.1| 30S ribosomal protein S20 [Escherichia coli FVEC1302]
 gi|300816055|ref|ZP_07096278.1| ribosomal protein S20 [Escherichia coli MS 107-1]
 gi|300821975|ref|ZP_07102119.1| ribosomal protein S20 [Escherichia coli MS 119-7]
 gi|300896786|ref|ZP_07115290.1| ribosomal protein S20 [Escherichia coli MS 198-1]
 gi|300905423|ref|ZP_07123190.1| ribosomal protein S20 [Escherichia coli MS 84-1]
 gi|300919572|ref|ZP_07136064.1| ribosomal protein S20 [Escherichia coli MS 115-1]
 gi|300924030|ref|ZP_07140030.1| ribosomal protein S20 [Escherichia coli MS 182-1]
 gi|300928682|ref|ZP_07144201.1| ribosomal protein S20 [Escherichia coli MS 187-1]
 gi|300939433|ref|ZP_07154095.1| ribosomal protein S20 [Escherichia coli MS 21-1]
 gi|300948624|ref|ZP_07162708.1| ribosomal protein S20 [Escherichia coli MS 116-1]
 gi|300956951|ref|ZP_07169203.1| ribosomal protein S20 [Escherichia coli MS 175-1]
 gi|300980953|ref|ZP_07175267.1| ribosomal protein S20 [Escherichia coli MS 45-1]
 gi|300984125|ref|ZP_07176876.1| ribosomal protein S20 [Escherichia coli MS 200-1]
 gi|301019795|ref|ZP_07183939.1| ribosomal protein S20 [Escherichia coli MS 69-1]
 gi|301048402|ref|ZP_07195429.1| ribosomal protein S20 [Escherichia coli MS 185-1]
 gi|301303537|ref|ZP_07209660.1| ribosomal protein S20 [Escherichia coli MS 124-1]
 gi|301330214|ref|ZP_07222874.1| ribosomal protein S20 [Escherichia coli MS 78-1]
 gi|301648413|ref|ZP_07248149.1| ribosomal protein S20 [Escherichia coli MS 146-1]
 gi|307311523|ref|ZP_07591165.1| ribosomal protein S20 [Escherichia coli W]
 gi|309797788|ref|ZP_07692172.1| ribosomal protein S20 [Escherichia coli MS 145-7]
 gi|331640471|ref|ZP_08341619.1| ribosomal protein S20 [Escherichia coli H736]
 gi|331645127|ref|ZP_08346238.1| ribosomal protein S20 [Escherichia coli M605]
 gi|331650913|ref|ZP_08351941.1| ribosomal protein S20 [Escherichia coli M718]
 gi|331661059|ref|ZP_08361991.1| ribosomal protein S20 [Escherichia coli TA206]
 gi|331661388|ref|ZP_08362312.1| ribosomal protein S20 [Escherichia coli TA143]
 gi|331666256|ref|ZP_08367137.1| ribosomal protein S20 [Escherichia coli TA271]
 gi|331671542|ref|ZP_08372340.1| ribosomal protein S20 [Escherichia coli TA280]
 gi|331680592|ref|ZP_08381251.1| ribosomal protein S20 [Escherichia coli H591]
 gi|331681405|ref|ZP_08382042.1| ribosomal protein S20 [Escherichia coli H299]
 gi|332281292|ref|ZP_08393705.1| 30S ribosomal subunit protein S20 [Shigella sp. D9]
 gi|62288964|sp|P0A7U7|RS20_ECOLI RecName: Full=30S ribosomal protein S20
 gi|62288965|sp|P0A7U8|RS20_ECOL6 RecName: Full=30S ribosomal protein S20
 gi|62288966|sp|P0A7U9|RS20_ECO57 RecName: Full=30S ribosomal protein S20
 gi|90111924|sp|Q326K0|RS20_SHIBS RecName: Full=30S ribosomal protein S20
 gi|90111925|sp|Q32K74|RS20_SHIDS RecName: Full=30S ribosomal protein S20
 gi|110825788|sp|Q3Z5Y7|RS20_SHISS RecName: Full=30S ribosomal protein S20
 gi|118573818|sp|Q0TLW7|RS20_ECOL5 RecName: Full=30S ribosomal protein S20
 gi|118573819|sp|Q1RGH9|RS20_ECOUT RecName: Full=30S ribosomal protein S20
 gi|167011211|sp|A7ZHB2|RS20_ECO24 RecName: Full=30S ribosomal protein S20
 gi|167011212|sp|A7ZVX1|RS20_ECOHS RecName: Full=30S ribosomal protein S20
 gi|189044862|sp|B1IRF1|RS20_ECOLC RecName: Full=30S ribosomal protein S20
 gi|226695421|sp|B2U242|RS20_SHIB3 RecName: Full=30S ribosomal protein S20
 gi|226736487|sp|B7MAE3|RS20_ECO45 RecName: Full=30S ribosomal protein S20
 gi|226736488|sp|B5YYB6|RS20_ECO5E RecName: Full=30S ribosomal protein S20
 gi|226736489|sp|B7NHC8|RS20_ECO7I RecName: Full=30S ribosomal protein S20
 gi|226736490|sp|B7M0B9|RS20_ECO8A RecName: Full=30S ribosomal protein S20
 gi|226736491|sp|B1XBE8|RS20_ECODH RecName: Full=30S ribosomal protein S20
 gi|226736492|sp|B7N7P7|RS20_ECOLU RecName: Full=30S ribosomal protein S20
 gi|226736493|sp|B6HZ18|RS20_ECOSE RecName: Full=30S ribosomal protein S20
 gi|226736494|sp|B1LFV4|RS20_ECOSM RecName: Full=30S ribosomal protein S20
 gi|226736496|sp|B7LVQ1|RS20_ESCF3 RecName: Full=30S ribosomal protein S20
 gi|254813102|sp|B7MNM8|RS20_ECO81 RecName: Full=30S ribosomal protein S20
 gi|254813103|sp|B7L4E5|RS20_ECO55 RecName: Full=30S ribosomal protein S20
 gi|254813104|sp|B7UI68|RS20_ECO27 RecName: Full=30S ribosomal protein S20
 gi|259494861|sp|C4ZPU9|RS20_ECOBW RecName: Full=30S ribosomal protein S20
 gi|116666567|pdb|1VS5|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|116666619|pdb|1VS7|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|256032363|pdb|3E1A|N Chain N, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Pre-Accommodation State
 gi|256032420|pdb|3E1C|N Chain N, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Post-Accommodation State
 gi|257097341|pdb|3I1M|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097393|pdb|3I1O|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097445|pdb|3I1Q|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097499|pdb|3I1S|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097553|pdb|3I1Z|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097608|pdb|3I21|T Chain T, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|290560326|pdb|3KC4|T Chain T, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
          Ribosomal Subnit. The 50s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kcr
 gi|308198706|pdb|3OR9|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308198727|pdb|3ORA|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|326634298|pdb|3IZV|X Chain X, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
          Ef-Tu
 gi|326634323|pdb|3IZW|X Chain X, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding.This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A Cognate
          Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|12512706|gb|AAG54325.1|AE005179_2 30S ribosomal subunit protein S20 [Escherichia coli O157:H7 str.
          EDL933]
 gi|26106341|gb|AAN78527.1|AE016755_27 30S ribosomal protein S20 [Escherichia coli CFT073]
 gi|581224|emb|CAA27968.1| ribosomal protein S20 [Escherichia coli K-12]
 gi|1786206|gb|AAC73134.1| 30S ribosomal subunit protein S20 [Escherichia coli str. K-12
          substr. MG1655]
 gi|13359482|dbj|BAB33449.1| 30S ribosomal subunit protein S20 [Escherichia coli O157:H7 str.
          Sakai]
 gi|21321906|dbj|BAB96593.1| 30S ribosomal subunit protein S20 [Escherichia coli str. K12
          substr. W3110]
 gi|73854118|gb|AAZ86825.1| 30S ribosomal subunit protein S20 [Shigella sonnei Ss046]
 gi|81239573|gb|ABB60283.1| 30S ribosomal subunit protein S20 [Shigella dysenteriae Sd197]
 gi|81244050|gb|ABB64758.1| 30S ribosomal subunit protein S20 [Shigella boydii Sb227]
 gi|91070654|gb|ABE05535.1| 30S ribosomal subunit protein S20 [Escherichia coli UTI89]
 gi|110341827|gb|ABG68064.1| 30S ribosomal protein S20 [Escherichia coli 536]
 gi|157065170|gb|ABV04425.1| ribosomal protein S20 [Escherichia coli HS]
 gi|157078520|gb|ABV18228.1| ribosomal protein S20 [Escherichia coli E24377A]
 gi|169756545|gb|ACA79244.1| ribosomal protein S20 [Escherichia coli ATCC 8739]
 gi|169887521|gb|ACB01228.1| 30S ribosomal subunit protein S20 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170122652|gb|EDS91583.1| ribosomal protein S20 [Escherichia albertii TW07627]
 gi|170521063|gb|ACB19241.1| ribosomal protein S20 [Escherichia coli SMS-3-5]
 gi|187428616|gb|ACD07890.1| ribosomal protein S20 [Shigella boydii CDC 3083-94]
 gi|188488995|gb|EDU64098.1| ribosomal protein S20 [Escherichia coli 53638]
 gi|189000680|gb|EDU69666.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4076]
 gi|189364238|gb|EDU82657.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4486]
 gi|189366956|gb|EDU85372.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4501]
 gi|189374893|gb|EDU93309.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC869]
 gi|190901053|gb|EDV60831.1| ribosomal protein S20 [Escherichia coli B7A]
 gi|208733718|gb|EDZ82405.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4045]
 gi|208739158|gb|EDZ86840.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4042]
 gi|209161127|gb|ACI38560.1| ribosomal protein S20 [Escherichia coli O157:H7 str. EC4115]
 gi|209747144|gb|ACI71879.1| 30S ribosomal subunit protein S20 [Escherichia coli]
 gi|209747146|gb|ACI71880.1| 30S ribosomal subunit protein S20 [Escherichia coli]
 gi|209747148|gb|ACI71881.1| 30S ribosomal subunit protein S20 [Escherichia coli]
 gi|209747150|gb|ACI71882.1| 30S ribosomal subunit protein S20 [Escherichia coli]
 gi|209747152|gb|ACI71883.1| 30S ribosomal subunit protein S20 [Escherichia coli]
 gi|209910471|dbj|BAG75545.1| 30S ribosomal protein S20 [Escherichia coli SE11]
 gi|215263256|emb|CAS07571.1| 30S ribosomal subunit protein S20 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217321323|gb|EEC29747.1| ribosomal protein S20 [Escherichia coli O157:H7 str. TW14588]
 gi|218350226|emb|CAU95909.1| 30S ribosomal subunit protein S20 [Escherichia coli 55989]
 gi|218354997|emb|CAQ87603.1| 30S ribosomal subunit protein S20 [Escherichia fergusonii ATCC
          35469]
 gi|218359375|emb|CAQ96914.1| 30S ribosomal subunit protein S20 [Escherichia coli IAI1]
 gi|218363729|emb|CAR01389.1| 30S ribosomal subunit protein S20 [Escherichia coli S88]
 gi|218368430|emb|CAR16166.1| 30S ribosomal subunit protein S20 [Escherichia coli IAI39]
 gi|218425461|emb|CAR06243.1| 30S ribosomal subunit protein S20 [Escherichia coli ED1a]
 gi|218430380|emb|CAR11247.1| 30S ribosomal subunit protein S20 [Escherichia coli UMN026]
 gi|222031854|emb|CAP74592.1| 30S ribosomal protein S20 [Escherichia coli LF82]
 gi|226840544|gb|EEH72546.1| ribosomal protein S20 [Escherichia sp. 1_1_43]
 gi|226902074|gb|EEH88333.1| 30S ribosomal subunit protein S20 [Escherichia sp. 3_2_53FAA]
 gi|227837912|gb|EEJ48378.1| 30S ribosomal protein S20 [Escherichia coli 83972]
 gi|238859795|gb|ACR61793.1| 30S ribosomal subunit protein S20 [Escherichia coli BW2952]
 gi|242375863|emb|CAQ30543.1| 30S ribosomal subunit protein S20, subunit of 30S ribosomal
          subunit and ribosome [Escherichia coli BL21(DE3)]
 gi|253325989|gb|ACT30591.1| ribosomal protein S20 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972050|gb|ACT37721.1| 30S ribosomal protein S20 [Escherichia coli B str. REL606]
 gi|253976259|gb|ACT41929.1| 30S ribosomal protein S20 [Escherichia coli BL21(DE3)]
 gi|254590558|gb|ACT69919.1| 30S ribosomal subunit protein S20 [Escherichia coli O157:H7 str.
          TW14359]
 gi|257751882|dbj|BAI23384.1| 30S ribosomal subunit protein S20 [Escherichia coli O26:H11 str.
          11368]
 gi|257757407|dbj|BAI28904.1| 30S ribosomal subunit protein S20 [Escherichia coli O103:H2 str.
          12009]
 gi|257762529|dbj|BAI34024.1| 30S ribosomal subunit protein S20 [Escherichia coli O111:H- str.
          11128]
 gi|260450767|gb|ACX41189.1| ribosomal protein S20 [Escherichia coli DH1]
 gi|281177234|dbj|BAI53564.1| 30S ribosomal protein S20 [Escherichia coli SE15]
 gi|284919805|emb|CBG32860.1| 30S ribosomal protein S20 [Escherichia coli 042]
 gi|290760719|gb|ADD54680.1| 30S ribosomal protein S20 [Escherichia coli O55:H7 str. CB9615]
 gi|291321139|gb|EFE60581.1| 30S ribosomal protein S20 [Escherichia coli B088]
 gi|291430011|gb|EFF03025.1| rpsT [Escherichia coli FVEC1412]
 gi|291430617|gb|EFF03615.1| 30S ribosomal protein S20 [Escherichia coli B185]
 gi|291472366|gb|EFF14848.1| 30S ribosomal protein S20 [Escherichia coli B354]
 gi|294492218|gb|ADE90974.1| ribosomal protein S20 [Escherichia coli IHE3034]
 gi|298280957|gb|EFI22458.1| 30S ribosomal protein S20 [Escherichia coli FVEC1302]
 gi|300299695|gb|EFJ56080.1| ribosomal protein S20 [Escherichia coli MS 185-1]
 gi|300306750|gb|EFJ61270.1| ribosomal protein S20 [Escherichia coli MS 200-1]
 gi|300316241|gb|EFJ66025.1| ribosomal protein S20 [Escherichia coli MS 175-1]
 gi|300359376|gb|EFJ75246.1| ribosomal protein S20 [Escherichia coli MS 198-1]
 gi|300399082|gb|EFJ82620.1| ribosomal protein S20 [Escherichia coli MS 69-1]
 gi|300402701|gb|EFJ86239.1| ribosomal protein S20 [Escherichia coli MS 84-1]
 gi|300409110|gb|EFJ92648.1| ribosomal protein S20 [Escherichia coli MS 45-1]
 gi|300413318|gb|EFJ96628.1| ribosomal protein S20 [Escherichia coli MS 115-1]
 gi|300419754|gb|EFK03065.1| ribosomal protein S20 [Escherichia coli MS 182-1]
 gi|300451850|gb|EFK15470.1| ribosomal protein S20 [Escherichia coli MS 116-1]
 gi|300455654|gb|EFK19147.1| ribosomal protein S20 [Escherichia coli MS 21-1]
 gi|300463351|gb|EFK26844.1| ribosomal protein S20 [Escherichia coli MS 187-1]
 gi|300525575|gb|EFK46644.1| ribosomal protein S20 [Escherichia coli MS 119-7]
 gi|300531262|gb|EFK52324.1| ribosomal protein S20 [Escherichia coli MS 107-1]
 gi|300841264|gb|EFK69024.1| ribosomal protein S20 [Escherichia coli MS 124-1]
 gi|300843776|gb|EFK71536.1| ribosomal protein S20 [Escherichia coli MS 78-1]
 gi|301073548|gb|EFK88354.1| ribosomal protein S20 [Escherichia coli MS 146-1]
 gi|306908502|gb|EFN39000.1| ribosomal protein S20 [Escherichia coli W]
 gi|307551864|gb|ADN44639.1| hypothetical protein ECABU_c00230 [Escherichia coli ABU 83972]
 gi|308118617|gb|EFO55879.1| ribosomal protein S20 [Escherichia coli MS 145-7]
 gi|309700236|emb|CBI99524.1| 30S ribosomal protein S20 [Escherichia coli ETEC H10407]
 gi|313646601|gb|EFS11062.1| ribosomal protein S20 [Shigella flexneri 2a str. 2457T]
 gi|315059249|gb|ADT73576.1| 30S ribosomal subunit protein S20 [Escherichia coli W]
 gi|315134717|dbj|BAJ41876.1| 30S ribosomal protein S20 [Escherichia coli DH1]
 gi|315255705|gb|EFU35673.1| ribosomal protein S20 [Escherichia coli MS 85-1]
 gi|315285016|gb|EFU44461.1| ribosomal protein S20 [Escherichia coli MS 110-3]
 gi|315293408|gb|EFU52760.1| ribosomal protein S20 [Escherichia coli MS 153-1]
 gi|315298463|gb|EFU57718.1| ribosomal protein S20 [Escherichia coli MS 16-3]
 gi|323380195|gb|ADX52463.1| ribosomal protein S20 [Escherichia coli KO11]
 gi|323935074|gb|EGB31441.1| ribosomal protein S20 [Escherichia coli E1520]
 gi|323939758|gb|EGB35960.1| ribosomal protein S20 [Escherichia coli E482]
 gi|323945761|gb|EGB41808.1| ribosomal protein S20 [Escherichia coli H120]
 gi|323950489|gb|EGB46367.1| ribosomal protein S20 [Escherichia coli H252]
 gi|323955217|gb|EGB50990.1| ribosomal protein S20 [Escherichia coli H263]
 gi|323959970|gb|EGB55616.1| ribosomal protein S20 [Escherichia coli H489]
 gi|323964881|gb|EGB60348.1| ribosomal protein S20 [Escherichia coli M863]
 gi|323970816|gb|EGB66069.1| ribosomal protein S20 [Escherichia coli TA007]
 gi|323975810|gb|EGB70906.1| ribosomal protein S20 [Escherichia coli TW10509]
 gi|324008364|gb|EGB77583.1| ribosomal protein S20 [Escherichia coli MS 57-2]
 gi|324012342|gb|EGB81561.1| ribosomal protein S20 [Escherichia coli MS 60-1]
 gi|324017712|gb|EGB86931.1| ribosomal protein S20 [Escherichia coli MS 117-3]
 gi|324112589|gb|EGC06566.1| ribosomal protein S20 [Escherichia fergusonii B253]
 gi|324118375|gb|EGC12269.1| ribosomal protein S20 [Escherichia coli E1167]
 gi|331040217|gb|EGI12424.1| ribosomal protein S20 [Escherichia coli H736]
 gi|331045884|gb|EGI18003.1| ribosomal protein S20 [Escherichia coli M605]
 gi|331051367|gb|EGI23416.1| ribosomal protein S20 [Escherichia coli M718]
 gi|331052101|gb|EGI24140.1| ribosomal protein S20 [Escherichia coli TA206]
 gi|331061303|gb|EGI33266.1| ribosomal protein S20 [Escherichia coli TA143]
 gi|331066467|gb|EGI38344.1| ribosomal protein S20 [Escherichia coli TA271]
 gi|331071387|gb|EGI42744.1| ribosomal protein S20 [Escherichia coli TA280]
 gi|331072055|gb|EGI43391.1| ribosomal protein S20 [Escherichia coli H591]
 gi|331081626|gb|EGI52787.1| ribosomal protein S20 [Escherichia coli H299]
 gi|332103644|gb|EGJ06990.1| 30S ribosomal subunit protein S20 [Shigella sp. D9]
          Length = 87

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|168230301|ref|ZP_02655359.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CDC 191]
 gi|205335183|gb|EDZ21947.1| ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CDC 191]
          Length = 88

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
            +KG+ H N A+R  + L+
Sbjct: 61 QAAKGLIHKNKAARHKANLT 80


>gi|296333287|ref|ZP_06875740.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305675208|ref|YP_003866880.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|296149485|gb|EFG90381.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305413452|gb|ADM38571.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. spizizenii
          str. W23]
          Length = 88

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K  +    R + N + +S++R+ ++    ++   + ++A  A  +A   I K
Sbjct: 1  MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   G+ H NAA+R  SRL+K++ G+
Sbjct: 61 AVKTGLVHKNAAARYKSRLAKKVNGL 86


>gi|262203075|ref|YP_003274283.1| 30S ribosomal protein S20 [Gordonia bronchialis DSM 43247]
 gi|262086422|gb|ACY22390.1| ribosomal protein S20 [Gordonia bronchialis DSM 43247]
          Length = 86

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 41/77 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R    R   N+S +SS+R+ +R   EA+  G  ++A E  + A   + K
Sbjct: 1  MANIKSQIKRNRTNEERRKRNQSVKSSLRTAIRGFREAVESGDKDKAAELGQAASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVS 77
          A SKG+ H N A+ K S
Sbjct: 61 AASKGVIHANQAANKKS 77


>gi|194476581|ref|YP_002048760.1| 30S ribosomal protein S20 [Paulinella chromatophora]
 gi|171191588|gb|ACB42550.1| 30S ribosomal protein S20 [Paulinella chromatophora]
          Length = 98

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEE---ATEACRKA 54
          MAN  S+KK ++   R  L N+S +S+VR+ ++    A+E+ +    EE     E   KA
Sbjct: 1  MANNKSSKKRVQVAERNRLENRSYKSAVRTLIKRCLTASESYSKEPSEETKTTVELTLKA 60

Query: 55 E-SVIQKAKSKGIFHGNAASRKVSRLS 80
            S I KA  +GI H NA + + SRLS
Sbjct: 61 AFSKIDKAVKRGILHRNAGAHQKSRLS 87


>gi|124022144|ref|YP_001016451.1| 30S ribosomal protein S20 [Prochlorococcus marinus str. MIT 9303]
 gi|166223967|sp|A2C6S6|RS20_PROM3 RecName: Full=30S ribosomal protein S20
 gi|123962430|gb|ABM77186.1| 30s Ribosomal protein S20 [Prochlorococcus marinus str. MIT 9303]
          Length = 100

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH-----ANEAITFGKIEEAT--EACRK 53
          MAN  S+KK ++   R  L NKS +S++R+ M+      +N +   G+  +A    +   
Sbjct: 1  MANNKSSKKRVQIAERNRLENKSYKSAMRTLMKRCFSACSNYSQQPGETAKANVKASIDS 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA  +G+ H N A+ + SRLS  +K  +  A
Sbjct: 61 AFSKIDKAVKRGVLHRNTAAHQKSRLSAAVKQAIEPA 97


>gi|81336020|sp|Q4QLU2|RS20_HAEI8 RecName: Full=30S ribosomal protein S20
 gi|68057752|gb|AAX88005.1| 30S ribosomal protein S20 [Haemophilus influenzae 86-028NP]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 3  LANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAESAFVEMQKVVDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 63 MASKGLIHANKAANHKSKLAAQIKKL 88


>gi|325295570|ref|YP_004282084.1| 30S ribosomal protein S20 [Desulfurobacterium thermolithotrophum
          DSM 11699]
 gi|325066018|gb|ADY74025.1| 30S ribosomal protein S20 [Desulfurobacterium thermolithotrophum
          DSM 11699]
          Length = 94

 Score = 37.4 bits (85), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SAKK +R+  +R   N+     +++  +   EA+    +E A E  + A   IQ+
Sbjct: 1  MPNTKSAKKRLRQNIKRRERNRYYTRRMKTEAKKVLEAVAEKNLEAAKEQLKVAMKWIQR 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A ++G  H N A+R++SR++
Sbjct: 61 AAARGAIHKNEAARRMSRIA 80


>gi|227498525|ref|ZP_03928669.1| 30S ribosomal protein S20 [Acidaminococcus sp. D21]
 gi|226903981|gb|EEH89899.1| 30S ribosomal protein S20 [Acidaminococcus sp. D21]
          Length = 87

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N   ++ +RS  R        G  +EA  A + A S++ K
Sbjct: 1  MPNIKSSVRSVKTDAERRAANGPVKAEIRSTARKVEAFAAAGSKDEAQAALKTAASLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG  +  AA+RK SRL+K++  +
Sbjct: 61 AARKGTVNKFAAARKKSRLAKKVNAV 86


>gi|220912733|ref|YP_002488042.1| 30S ribosomal protein S20 [Arthrobacter chlorophenolicus A6]
 gi|254813041|sp|B8H8S5|RS20_ARTCA RecName: Full=30S ribosomal protein S20
 gi|219859611|gb|ACL39953.1| ribosomal protein S20 [Arthrobacter chlorophenolicus A6]
          Length = 86

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  L N + +S +R+ +R  N A+     + A  A   A   + K
Sbjct: 1  MANIKSQKKRILTNEKARLRNNAVKSELRTAIRAVNTAVESADKDAAATALVSASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S +SK++  +
Sbjct: 61 AVSKGVLHKNNAANRKSAISKKVNAL 86


>gi|253998230|ref|YP_003050293.1| 30S ribosomal protein S20 [Methylovorus sp. SIP3-4]
 gi|313200302|ref|YP_004038960.1| 30S ribosomal protein S20 [Methylovorus sp. MP688]
 gi|253984909|gb|ACT49766.1| ribosomal protein S20 [Methylovorus sp. SIP3-4]
 gi|312439618|gb|ADQ83724.1| ribosomal protein S20 [Methylovorus sp. MP688]
          Length = 87

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS++R+ ++   +A+  G    A  A  +  SVI +
Sbjct: 1  MANSAQARKRARQAVKQRAHNASLRSTLRTAIKKIIKAVEAGDKAAAQTAYIENVSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKNIIHKNKAARHKSRLSASIKAM 86


>gi|319949558|ref|ZP_08023605.1| 30S ribosomal protein S20 [Dietzia cinnamea P4]
 gi|319436776|gb|EFV91849.1| 30S ribosomal protein S20 [Dietzia cinnamea P4]
          Length = 86

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R   R  L N+S +S++R+ +R   EA   G  E+A          + K
Sbjct: 1  MANIKSQIKRNRTNERNRLRNQSTKSALRTAIRSLREATESGDKEKAGALLVATSRQLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H N A+ K S L+K
Sbjct: 61 AASKGVIHQNQAANKKSALTK 81


>gi|295394829|ref|ZP_06805044.1| 30S ribosomal protein S20 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972425|gb|EFG48285.1| 30S ribosomal protein S20 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 86

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R   +  L N + RS V+S +R   E I  G  EEA  A   A   + K
Sbjct: 1  MANIKSQIKRNRTNEKARLRNVAVRSEVKSAIRKVREQIEAGNAEEAQAAFAVATRKLDK 60

Query: 61 AKSKGIFHG-NAASRKVSRLSKRLKGI 86
          A SKG+ H  NAA+RK S+L++++  +
Sbjct: 61 AVSKGVLHKRNAANRK-SKLAQKVNAL 86


>gi|317968939|ref|ZP_07970329.1| 30S ribosomal protein S20 [Synechococcus sp. CB0205]
          Length = 100

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK I    R  L N++ +S+VR+ M+    A T    E    A +  +S +  
Sbjct: 1  MANNKSSKKRIEVAERNRLHNRTYKSAVRTLMKRCFAACTAYSQEPGDAAKQAVQSSLSA 60

Query: 61 AKSK-------GIFHGNAASRKVSRLSKRLKGILTSA 90
          A SK       G+ H N  + + SRLS  +K  +  A
Sbjct: 61 AFSKIDKAVKVGVLHRNNGAHQKSRLSAAVKSAIEPA 97


>gi|82702166|ref|YP_411732.1| ribosomal protein S20 [Nitrosospira multiformis ATCC 25196]
 gi|115305693|sp|Q2YA81|RS20_NITMU RecName: Full=30S ribosomal protein S20
 gi|82410231|gb|ABB74340.1| SSU ribosomal protein S20P [Nitrosospira multiformis ATCC 25196]
          Length = 87

 Score = 37.0 bits (84), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 1  MANKDSAKKMIRK-IARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59
          MAN   A+K  R+ I+ R   N S RS +R+ ++H  +AI       A  A + + + I 
Sbjct: 1  MANSAQARKRARQNISHRNR-NMSLRSELRTAIKHVRKAIGSADKNTAQAAYQASVATID 59

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGI 86
              KGI H N A+R  SRLS  +K +
Sbjct: 60 SIADKGIIHKNKAARHKSRLSSAIKAM 86


>gi|329296600|ref|ZP_08253936.1| 30S ribosomal protein S20 [Plautia stali symbiont]
          Length = 87

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK      +R   N S RS +R+F++    AI  G    A  A  + + ++  
Sbjct: 1  MANIKSAKKRAVTSEKRRKHNASNRSMMRTFIKKVYAAIATGDKAAAQNAFNEMQPIVDH 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|116333995|ref|YP_795522.1| 30S ribosomal protein S20 [Lactobacillus brevis ATCC 367]
 gi|122269321|sp|Q03QN1|RS20_LACBA RecName: Full=30S ribosomal protein S20
 gi|116099342|gb|ABJ64491.1| SSU ribosomal protein S20P [Lactobacillus brevis ATCC 367]
          Length = 84

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N ++ S++R+ ++   +A T G  + A E  RKA + + KA SKG+   N ASR  SR++
Sbjct: 21 NSAQLSTMRTAVKRFEQAKTAG-ADNAEELYRKASAAVDKAASKGLIKRNKASRDKSRMA 79

Query: 81 KRL 83
           RL
Sbjct: 80 ARL 82


>gi|15609549|ref|NP_216928.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis H37Rv]
 gi|15841930|ref|NP_336967.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis CDC1551]
 gi|31793591|ref|NP_856084.1| 30S ribosomal protein S20 [Mycobacterium bovis AF2122/97]
 gi|121638293|ref|YP_978517.1| 30S ribosomal protein S20 [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|148662246|ref|YP_001283769.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis H37Ra]
 gi|148823615|ref|YP_001288369.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis F11]
 gi|167969729|ref|ZP_02552006.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis H37Ra]
 gi|215404346|ref|ZP_03416527.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis 02_1987]
 gi|215412164|ref|ZP_03420928.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis 94_M4241A]
 gi|215446656|ref|ZP_03433408.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis T85]
 gi|218754141|ref|ZP_03532937.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis GM 1503]
 gi|219558407|ref|ZP_03537483.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis T17]
 gi|224990787|ref|YP_002645474.1| 30S ribosomal protein S20 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253798510|ref|YP_003031511.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis KZN
          1435]
 gi|254232550|ref|ZP_04925877.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis C]
 gi|254365187|ref|ZP_04981233.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis str.
          Haarlem]
 gi|254551459|ref|ZP_05141906.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260187418|ref|ZP_05764892.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis CPHL_A]
 gi|260201538|ref|ZP_05769029.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis T46]
 gi|260205715|ref|ZP_05773206.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis K85]
 gi|289443935|ref|ZP_06433679.1| SSU ribosomal protein S20 [Mycobacterium tuberculosis T46]
 gi|289448054|ref|ZP_06437798.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          CPHL_A]
 gi|289553798|ref|ZP_06443008.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis KZN
          605]
 gi|289570560|ref|ZP_06450787.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis T17]
 gi|289575105|ref|ZP_06455332.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis K85]
 gi|289746193|ref|ZP_06505571.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          02_1987]
 gi|289758540|ref|ZP_06517918.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis T85]
 gi|289762579|ref|ZP_06521957.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis GM
          1503]
 gi|294994480|ref|ZP_06800171.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis 210]
 gi|297635016|ref|ZP_06952796.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis KZN 4207]
 gi|297732008|ref|ZP_06961126.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis KZN R506]
 gi|298525894|ref|ZP_07013303.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis 94_M4241A]
 gi|306776679|ref|ZP_07415016.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu001]
 gi|306780453|ref|ZP_07418790.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu002]
 gi|306785203|ref|ZP_07423525.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu003]
 gi|306789564|ref|ZP_07427886.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu004]
 gi|306793889|ref|ZP_07432191.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu005]
 gi|306798286|ref|ZP_07436588.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu006]
 gi|306804161|ref|ZP_07440829.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu008]
 gi|306808732|ref|ZP_07445400.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu007]
 gi|306968562|ref|ZP_07481223.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu009]
 gi|306972791|ref|ZP_07485452.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu010]
 gi|307080496|ref|ZP_07489666.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu011]
 gi|307085094|ref|ZP_07494207.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu012]
 gi|313659343|ref|ZP_07816223.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis KZN V2475]
 gi|54039471|sp|P66506|RS20_MYCBO RecName: Full=30S ribosomal protein S20
 gi|54042163|sp|P66505|RS20_MYCTU RecName: Full=30S ribosomal protein S20
 gi|166223949|sp|A1KLA4|RS20_MYCBP RecName: Full=30S ribosomal protein S20
 gi|166223953|sp|A5U5A7|RS20_MYCTA RecName: Full=30S ribosomal protein S20
 gi|254813093|sp|C1AQX7|RS20_MYCBT RecName: Full=30S ribosomal protein S20
 gi|1655647|emb|CAB03746.1| PROBABLE 30S RIBOSOMAL PROTEIN S20 RPST [Mycobacterium
          tuberculosis H37Rv]
 gi|13882201|gb|AAK46781.1| ribosomal protein S20 [Mycobacterium tuberculosis CDC1551]
 gi|31619184|emb|CAD97296.1| PROBABLE 30S RIBOSOMAL PROTEIN S20 RPST [Mycobacterium bovis
          AF2122/97]
 gi|121493941|emb|CAL72416.1| Probable 30S ribosomal protein S20 rpsT [Mycobacterium bovis BCG
          str. Pasteur 1173P2]
 gi|124601609|gb|EAY60619.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis C]
 gi|134150701|gb|EBA42746.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis str.
          Haarlem]
 gi|148506398|gb|ABQ74207.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis H37Ra]
 gi|148722142|gb|ABR06767.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis F11]
 gi|224773900|dbj|BAH26706.1| 30S ribosomal protein S20 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253320013|gb|ACT24616.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis KZN
          1435]
 gi|289416854|gb|EFD14094.1| SSU ribosomal protein S20 [Mycobacterium tuberculosis T46]
 gi|289421012|gb|EFD18213.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          CPHL_A]
 gi|289438430|gb|EFD20923.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis KZN
          605]
 gi|289539536|gb|EFD44114.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis K85]
 gi|289544314|gb|EFD47962.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis T17]
 gi|289686721|gb|EFD54209.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          02_1987]
 gi|289710085|gb|EFD74101.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis GM
          1503]
 gi|289714104|gb|EFD78116.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis T85]
 gi|298495688|gb|EFI30982.1| 30S ribosomal protein S20 [Mycobacterium tuberculosis 94_M4241A]
 gi|308214928|gb|EFO74327.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu001]
 gi|308326689|gb|EFP15540.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu002]
 gi|308330117|gb|EFP18968.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu003]
 gi|308333957|gb|EFP22808.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu004]
 gi|308337769|gb|EFP26620.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu005]
 gi|308341431|gb|EFP30282.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu006]
 gi|308344927|gb|EFP33778.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu007]
 gi|308349238|gb|EFP38089.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu008]
 gi|308353859|gb|EFP42710.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu009]
 gi|308357803|gb|EFP46654.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu010]
 gi|308361748|gb|EFP50599.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu011]
 gi|308365358|gb|EFP54209.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          SUMu012]
 gi|323719009|gb|EGB28158.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis
          CDC1551A]
 gi|326904029|gb|EGE50962.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis W-148]
 gi|328458278|gb|AEB03701.1| 30S ribosomal protein S20 rpsT [Mycobacterium tuberculosis KZN
          4207]
          Length = 86

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K  R   R  L NK+ +SS+R+ +R   EA   G   +A E        + K
Sbjct: 1  MANIKSQQKRNRTNERARLRNKAVKSSLRTAVRAFREAAHAGDKAKAAELLASTNRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+ K S L++ L
Sbjct: 61 AASKGVIHKNQAANKKSALAQAL 83


>gi|11467691|ref|NP_050743.1| ribosomal protein S20 [Guillardia theta]
 gi|6094136|sp|O78486|RR20_GUITH RecName: Full=30S ribosomal protein S20, chloroplastic
 gi|3603016|gb|AAC35677.1| ribosomal protein S20 [Guillardia theta]
          Length = 95

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFGKIEEATEACRK----AE 55
          MAN  SA K I    R  L NK+ +S ++++ +    AI T    +  T   R+     +
Sbjct: 1  MANSASAIKRIELNERNRLRNKTYKSMLKTYYKKCIVAIETTNNNDLETSNLRELVAITQ 60

Query: 56 SVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
          S I KA  KGI H N  S K ++L+KRLK
Sbjct: 61 SKIDKAVQKGIIHSNNGSAKKAKLTKRLK 89


>gi|73542450|ref|YP_296970.1| 30S ribosomal protein S20 [Ralstonia eutropha JMP134]
 gi|118574556|sp|Q46XK7|RS20_RALEJ RecName: Full=30S ribosomal protein S20
 gi|72119863|gb|AAZ62126.1| SSU ribosomal protein S20P [Ralstonia eutropha JMP134]
          Length = 88

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   +   N S RS +R+ ++   +AI  G    A E  + +++ I  
Sbjct: 1  MANSAQARKRARQAVAQNAHNSSLRSRLRTAVKAVRKAIDAGDKAAAAEIFKNSQATIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAIKAM 86


>gi|325265373|ref|ZP_08132097.1| ribosomal protein S20 [Clostridium sp. D5]
 gi|324029374|gb|EGB90665.1| ribosomal protein S20 [Clostridium sp. D5]
          Length = 102

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 47  ATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           A  A + A + I KA SKG++H N  +RK+SRLSK +  I
Sbjct: 62  AKTALQAAITEISKAGSKGVYHKNTVARKISRLSKAVNDI 101


>gi|203287690|ref|YP_002222705.1| 30S ribosomal protein S20 [Borrelia recurrentis A1]
 gi|201084910|gb|ACH94484.1| 30S ribosomal protein S20 [Borrelia recurrentis A1]
          Length = 108

 Score = 37.0 bits (84), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           + N  SA K  R+  +R L N S +S +++  +H  + I  GK +EA E  +     +  
Sbjct: 24  LGNNPSALKRARQNLKRNLRNVSVKSELKTLEKHCIKLIKDGKKDEALEFFKFVSKKLDT 83

Query: 61  AKSKGIFHGNAASRKVSRLS 80
           A  K I H N A+RK S LS
Sbjct: 84  AARKRIIHINKAARKKSNLS 103


>gi|59798857|sp|Q7VKC6|RS20_HAEDU RecName: Full=30S ribosomal protein S20
 gi|33149189|gb|AAP96706.1| 30S ribosomal protein S20 [Haemophilus ducreyi 35000HP]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N S+RS +R+F++    AI  G    +  A  + + V+ +
Sbjct: 3  LANIKSAKKRAVQSEKRRQHNASQRSMMRTFIKKVYAAIATGDKAASQTAFVEMQKVVDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   ++L  ++K +
Sbjct: 63 MASKGLIHANKAANHKAKLVAQIKKL 88


>gi|260580055|ref|ZP_05847885.1| ribosomal protein S20 [Haemophilus influenzae RdAW]
 gi|260581954|ref|ZP_05849750.1| ribosomal protein S20 [Haemophilus influenzae NT127]
 gi|3212207|gb|AAC22624.1| ribosomal protein S20 (rpS20) [Haemophilus influenzae Rd KW20]
 gi|260093339|gb|EEW77272.1| ribosomal protein S20 [Haemophilus influenzae RdAW]
 gi|260095147|gb|EEW79039.1| ribosomal protein S20 [Haemophilus influenzae NT127]
 gi|309973533|gb|ADO96734.1| 30S ribosomal protein S20 [Haemophilus influenzae R2846]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +R   N S+RS +R++++     +  G+   A  A  + + V+ +
Sbjct: 3  LANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAEAAFVEMQKVVDR 62

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            SKG+ H N A+   S+L+ ++K +
Sbjct: 63 MASKGLIHANKAANHKSKLAAQIKKL 88


>gi|71894095|ref|YP_278203.1| 30S ribosomal protein S20 [Mycoplasma synoviae 53]
 gi|115305691|sp|Q4A6X9|RS20_MYCS5 RecName: Full=30S ribosomal protein S20
 gi|71850883|gb|AAZ43492.1| 30S ribosomal protein S20 [Mycoplasma synoviae 53]
          Length = 88

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I +I    + N + +S V+  +R A EAI      +A E   KA   I K
Sbjct: 1  MANIKSKIKNISRIETARVKNAAIKSRVKKAIRKAREAI-LENSPKAQELVNKAHHEIGK 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG+ H N  +RK SRL 
Sbjct: 60 AVSKGVMHLNKGARKSSRLD 79


>gi|67922539|ref|ZP_00516047.1| Ribosomal protein S20p [Crocosphaera watsonii WH 8501]
 gi|67855623|gb|EAM50874.1| Ribosomal protein S20p [Crocosphaera watsonii WH 8501]
          Length = 100

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 20/101 (19%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEE-------------- 46
          MAN  SA K I+   R  L NKS +S+VR+ M+       F  +EE              
Sbjct: 1  MANSKSALKRIKVAERNRLRNKSYKSAVRTLMKK-----YFQAVEEYAASSTEEKEEKEK 55

Query: 47 -ATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
             +    A S I KA  + + H N  +RK +RL+K LK +
Sbjct: 56 VVQQMMSAAYSKIDKAVKRNVLHRNNGARKKARLAKALKKV 96


>gi|260901094|ref|ZP_05909489.1| ribosomal protein S20 [Vibrio parahaemolyticus AQ4037]
 gi|308107468|gb|EFO45008.1| ribosomal protein S20 [Vibrio parahaemolyticus AQ4037]
          Length = 64

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%)

Query: 23 SRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKR 82
          SRRS +R++M+    AI  G  E AT A      ++ +  +KG+ H N A+R  SR + +
Sbjct: 1  SRRSMMRTYMKKTVAAIEAGDKEAATAAFAVVTPILDRMATKGLIHKNKAARHKSRFAAQ 60

Query: 83 LKGI 86
          +K +
Sbjct: 61 IKAL 64


>gi|302545461|ref|ZP_07297803.1| ribosomal protein S20 [Streptomyces hygroscopicus ATCC 53653]
 gi|302463079|gb|EFL26172.1| ribosomal protein S20 [Streptomyces himastatinicus ATCC 53653]
          Length = 135

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 19  LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
           L NK+ +S +++ +R   EA+  G  E+AT A R A   + KA SKG+ H N A+ K S 
Sbjct: 66  LRNKAVKSELKTAIRRTREAVAAGDAEKATAAARAAARKLDKAVSKGVLHKNNAANKKSA 125

Query: 79  LSKRLKGI 86
           L+++L G+
Sbjct: 126 LAQQLAGL 133


>gi|329120690|ref|ZP_08249352.1| trigger factor [Neisseria bacilliformis ATCC BAA-1200]
 gi|327460487|gb|EGF06823.1| trigger factor [Neisseria bacilliformis ATCC BAA-1200]
          Length = 87

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N   R++ R+ ++   +A+  G    A     ++  +I +
Sbjct: 1  MANSAQARKRARQAVKNRAHNAGLRTAFRTAVKKVLKAVEAGDKAAAQAVYVQSVKIIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+FH N A+R  SRLS ++K +
Sbjct: 61 IADKGVFHKNKAARHKSRLSAKIKAM 86


>gi|284051611|ref|ZP_06381821.1| 30S ribosomal protein S20 [Arthrospira platensis str. Paraca]
          Length = 118

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEATEACRK---- 53
           MAN  SA K ++   R  L N+S  S+VR+ M+    A E       +E+ +  ++    
Sbjct: 14  MANIKSAIKRVQIAERNRLRNRSYNSAVRTLMKKYFAAVEQYAANPTDESLQYVQQRMSE 73

Query: 54  AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
             S I KA   G+ H N A+RK SRL++ LK
Sbjct: 74  TTSKIDKAVKVGVLHRNNAARKKSRLARFLK 104


>gi|262195528|ref|YP_003266737.1| ribosomal protein S20 [Haliangium ochraceum DSM 14365]
 gi|262078875|gb|ACY14844.1| ribosomal protein S20 [Haliangium ochraceum DSM 14365]
          Length = 88

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   R L N+    ++R+ ++ A  A+   K  EA +  + A S I +
Sbjct: 1  MANSKQAEKRDRQRESRRLRNRLTIGNMRTALKRARAAVD-AKAPEADKLVKSAVSAIDR 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A  KG+   N  SR +SRL K + G
Sbjct: 60 AVGKGVLKRNTGSRYISRLLKHVGG 84


>gi|228477607|ref|ZP_04062240.1| ribosomal protein S20 [Streptococcus salivarius SK126]
 gi|228250751|gb|EEK09949.1| ribosomal protein S20 [Streptococcus salivarius SK126]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S +R A +A      EEA    R A + I KA SKG+ H N ASR  SRL+ +L
Sbjct: 20 KNSAQKSALRTAIKAFNANPTEEA---YRAASASIDKAASKGLIHKNKASRDKSRLAAKL 76


>gi|110804091|ref|YP_687611.1| 30S ribosomal protein S20 [Shigella flexneri 5 str. 8401]
 gi|122957687|sp|Q0T8H0|RS20_SHIF8 RecName: Full=30S ribosomal protein S20
 gi|110613639|gb|ABF02306.1| 30S ribosomal subunit protein S20 [Shigella flexneri 5 str. 8401]
          Length = 87

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +   I  SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKARKIIASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|255582939|ref|XP_002532240.1| 30S ribosomal protein S20, putative [Ricinus communis]
 gi|223528058|gb|EEF30134.1| 30S ribosomal protein S20, putative [Ricinus communis]
          Length = 185

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 9/91 (9%)

Query: 5   DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI------TFGKIEEATEACR---KAE 55
           DSA K  R+  +R + +K+ +S VR+ M+   EA+      +  + EE     +   +A 
Sbjct: 78  DSAAKRARQAEKRRIYHKAHKSEVRTRMKKVLEALDDLRKKSDAQAEEVLPIEKLIAEAY 137

Query: 56  SVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           SVI KA   G  H N  +R+ SRL++R K +
Sbjct: 138 SVIDKAVKVGTLHRNTGARRKSRLARRKKAV 168


>gi|325687969|gb|EGD29989.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK72]
          Length = 78

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  SRLS +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKSRLSAKL 76


>gi|269792314|ref|YP_003317218.1| 30S ribosomal protein S20 [Thermanaerovibrio acidaminovorans DSM
          6589]
 gi|269099949|gb|ACZ18936.1| ribosomal protein S20 [Thermanaerovibrio acidaminovorans DSM
          6589]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 48/90 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M NK SA K +    R  L N+  ++  ++ ++   EA+    ++ A +   +A+ V+ K
Sbjct: 1  MPNKKSAAKRVLVAERNRLYNRFWKTRCKNAIKKVLEAVQSKDVDMAKKRLDEAQKVLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A  KG+ H N A+R+ S ++ ++  ++  A
Sbjct: 61 AVVKGVIHRNTAARRKSGVAAKVHALVKGA 90


>gi|88807330|ref|ZP_01122842.1| 30S ribosomal protein S20 [Synechococcus sp. WH 7805]
 gi|88788544|gb|EAR19699.1| 30S ribosomal protein S20 [Synechococcus sp. WH 7805]
          Length = 102

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMR---HANEAITFGKIEEATEACRKAESV 57
          MAN  S+KK +    R  L NK+ +SS+R+ M+    A E  +    +EA    + + S 
Sbjct: 1  MANNKSSKKRVEIAERSRLQNKAYKSSMRTLMKRCFSACETYSATPGDEAKSTVQSSMSA 60

Query: 58 ----IQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
              I KA  +G+ H NA + + +RLS  +K  +  A
Sbjct: 61 AFSKIDKAVKRGVLHRNAGAHQKARLSMAVKKAIDPA 97


>gi|17547275|ref|NP_520677.1| 30S ribosomal protein S20 [Ralstonia solanacearum GMI1000]
 gi|20978682|sp|Q8XWB8|RS20_RALSO RecName: Full=30S ribosomal protein S20
 gi|17429577|emb|CAD16263.1| probable 30s ribosomal protein s20 [Ralstonia solanacearum
          GMI1000]
 gi|299065832|emb|CBJ37011.1| 30S ribosomal subunit protein S20 [Ralstonia solanacearum CMR15]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+   +   N + RS +R+ ++   +AI  G    A    ++A+S I  
Sbjct: 1  MANTAQARKRARQAVVQNAHNSALRSRLRTAVKAVRKAIAGGDKAAAANVFKQAQSTIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARAKSRLSAAIKAM 86


>gi|291568315|dbj|BAI90587.1| 30S ribosomal protein S20 [Arthrospira platensis NIES-39]
          Length = 105

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEATEACRK---- 53
          MAN  SA K ++   R  L N+S  S+VR+ M+    A E       +E+ +  ++    
Sbjct: 1  MANIKSAIKRVQIAERNRLRNRSYNSAVRTLMKKYFAAVEQYAANPTDESLQYVQQRMSE 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
            S I KA   G+ H N A+RK SRL++ LK
Sbjct: 61 TTSKIDKAVKVGVLHRNNAARKKSRLARFLK 91


>gi|14090071|emb|CAC13829.1| 30S RIBOSOMAL PROTEIN S20 [Mycoplasma pulmonis]
          Length = 110

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           MAN  S  K I+ + +    N   +S V++ ++ A  AIT    + A +    A   I K
Sbjct: 22  MANIKSKIKSIKTMEKARKRNSMIKSRVKTSIKKAKLAITQDS-DNAKKLVSDAHHEIHK 80

Query: 61  AKSKGIFHGNAASRKVSRLS 80
           AKSKG+FH N A RK SRL 
Sbjct: 81  AKSKGVFHKNTALRKSSRLD 100


>gi|319786580|ref|YP_004146055.1| ribosomal protein S20 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465092|gb|ADV26824.1| ribosomal protein S20 [Pseudoxanthomonas suwonensis 11-1]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++   R   N ++RS +R+ ++   +A+       A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAKQTVVRNARNTAQRSQLRTAVKKVLKALDANDAAGAEAAFAIAQPLLDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+R  SRL+ R+K I
Sbjct: 61 FSARGLIHKNKAARHKSRLTARIKAI 86


>gi|302391383|ref|YP_003827203.1| 30S ribosomal protein S20P [Acetohalobium arabaticum DSM 5501]
 gi|302203460|gb|ADL12138.1| SSU ribosomal protein S20P [Acetohalobium arabaticum DSM 5501]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%)

Query: 47 ATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
          A E  R+A+  I KA +KGI H N A+R+ S+L +R+  ++
Sbjct: 47 AKEELREAKQTIDKAVTKGILHENTAARRKSKLERRVNKLI 87


>gi|222153105|ref|YP_002562282.1| 30S ribosomal protein S20 [Streptococcus uberis 0140J]
 gi|254813066|sp|B9DS97|RS20_STRU0 RecName: Full=30S ribosomal protein S20
 gi|222113918|emb|CAR42128.1| 30S ribosomal protein S20 [Streptococcus uberis 0140J]
          Length = 77

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPTEEL---FRAASSSIDKAESKGLIHANKASRDKARLAAKL 76


>gi|254421684|ref|ZP_05035402.1| ribosomal protein S20 [Synechococcus sp. PCC 7335]
 gi|196189173|gb|EDX84137.1| ribosomal protein S20 [Synechococcus sp. PCC 7335]
          Length = 108

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SA K IR   R  L NK+ +S+V++  +  +EA+     +   E  +  +     
Sbjct: 1  MANTKSAIKRIRVAERNRLRNKAYKSAVKTLTKRYHEALEANASDPTDENSQLVQERMSA 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSR 78
            S I KA  +G+ H NA +R+ SR
Sbjct: 61 VVSKIDKAVKRGVLHKNAGARRKSR 85


>gi|161723290|ref|NP_326487.2| 30S ribosomal protein S20 [Mycoplasma pulmonis UAB CTIP]
 gi|17865586|sp|Q98PR3|RS20_MYCPU RecName: Full=30S ribosomal protein S20
          Length = 89

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+ + +    N   +S V++ ++ A  AIT    + A +    A   I K
Sbjct: 1  MANIKSKIKSIKTMEKARKRNSMIKSRVKTSIKKAKLAITQDS-DNAKKLVSDAHHEIHK 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          AKSKG+FH N A RK SRL 
Sbjct: 60 AKSKGVFHKNTALRKSSRLD 79


>gi|255325523|ref|ZP_05366625.1| ribosomal protein S20 [Corynebacterium tuberculostearicum SK141]
 gi|311741310|ref|ZP_07715134.1| 30S ribosomal protein S20 [Corynebacterium pseudogenitalium ATCC
          33035]
 gi|255297461|gb|EET76776.1| ribosomal protein S20 [Corynebacterium tuberculostearicum SK141]
 gi|311303480|gb|EFQ79559.1| 30S ribosomal protein S20 [Corynebacterium pseudogenitalium ATCC
          33035]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NKS RS+VR+ +R   E +  G    A +  R A   + K+ SKG+FH N A+ K S ++
Sbjct: 21 NKSVRSAVRTEIRKFRETVAAGDKAAAEKQLRVASRALDKSVSKGVFHRNTAANKKSGMA 80


>gi|293392924|ref|ZP_06637241.1| 30S ribosomal protein S20 [Serratia odorifera DSM 4582]
 gi|291424458|gb|EFE97670.1| 30S ribosomal protein S20 [Serratia odorifera DSM 4582]
          Length = 61

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 28 VRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          VR+F++  + AI  G  E A  A    + ++ +  +KG+ H N A+R  S LS R+  +
Sbjct: 2  VRTFIKKVDAAIAAGDKEAAQNAFTVMQPLVDRQAAKGLIHKNKAARHKSNLSARINAM 60


>gi|205351386|ref|YP_002225187.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|226695414|sp|B5RF40|RS20_SALG2 RecName: Full=30S ribosomal protein S20
 gi|205271167|emb|CAR35954.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|326626406|gb|EGE32749.1| 30S ribosomal protein S20 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
             KG+ H N A+R  + L+ ++
Sbjct: 61 QAVKGLIHKNKAARHKANLTAQI 83


>gi|261337368|ref|ZP_05965252.1| ribosomal protein S20 [Bifidobacterium gallicum DSM 20093]
 gi|270277748|gb|EFA23602.1| ribosomal protein S20 [Bifidobacterium gallicum DSM 20093]
          Length = 86

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK +    +  + N S +S++++ +RH  EAI  G    A E    A   + K
Sbjct: 1  MANIKSQKKRVLTNQKAHMRNVSVKSALKTAVRHVREAIAAGDKALAEEKFAIASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S L+ ++  +
Sbjct: 61 AASKGVIHKNQAANRKSSLALQINAM 86


>gi|78067352|ref|YP_370121.1| 30S ribosomal protein S20 [Burkholderia sp. 383]
 gi|115305674|sp|Q39DI9|RS20_BURS3 RecName: Full=30S ribosomal protein S20
 gi|77968097|gb|ABB09477.1| SSU ribosomal protein S20P [Burkholderia sp. 383]
          Length = 90

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +A+  G   +A +  + A   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAVDAGDQAKAADLFKAAVKTIDT 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+  +A
Sbjct: 61 IADKKIVHKNKAARSKSRLAAAVKGLQAAA 90


>gi|57238624|ref|YP_179755.1| 30S ribosomal protein S20 [Campylobacter jejuni RM1221]
 gi|86152254|ref|ZP_01070465.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86153107|ref|ZP_01071312.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          HB93-13]
 gi|121612762|ref|YP_001001254.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          81-176]
 gi|148925755|ref|ZP_01809443.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          CG8486]
 gi|157415830|ref|YP_001483086.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          81116]
 gi|167006148|ref|ZP_02271906.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|205355625|ref|ZP_03222395.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          CG8421]
 gi|283953775|ref|ZP_06371306.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 414]
 gi|283956994|ref|ZP_06374466.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 1336]
 gi|62510976|sp|Q5HSI0|RS20_CAMJR RecName: Full=30S ribosomal protein S20
 gi|166223924|sp|A1W1L3|RS20_CAMJJ RecName: Full=30S ribosomal protein S20
 gi|172047201|sp|A8FNS2|RS20_CAMJ8 RecName: Full=30S ribosomal protein S20
 gi|57167428|gb|AAW36207.1| ribosomal protein S20 [Campylobacter jejuni RM1221]
 gi|85840743|gb|EAQ57994.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85843992|gb|EAQ61202.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          HB93-13]
 gi|87249577|gb|EAQ72536.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|145845765|gb|EDK22856.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          CG8486]
 gi|157386794|gb|ABV53109.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 81116]
 gi|205346402|gb|EDZ33035.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni
          CG8421]
 gi|283791495|gb|EFC30292.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 1336]
 gi|283794816|gb|EFC33554.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 414]
 gi|307748467|gb|ADN91737.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. jejuni M1]
 gi|315059062|gb|ADT73391.1| SSU ribosomal protein S20p [Campylobacter jejuni subsp. jejuni
          S3]
 gi|315931655|gb|EFV10616.1| ribosomal protein S20 [Campylobacter jejuni subsp. jejuni 327]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  ++T  N+  R+ +++  +   EA   G    A EA + A   I  
Sbjct: 1  MANHKSAEKRARQTIKKTERNRFYRTRLKNITKAVREAAANGDKNAANEALKVANKSIHA 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
            S+G      ASR+VSRL+
Sbjct: 61 MVSRGFIKKQTASRRVSRLA 80


>gi|186475299|ref|YP_001856769.1| 30S ribosomal protein S20 [Burkholderia phymatum STM815]
 gi|226736376|sp|B2JDU7|RS20_BURP8 RecName: Full=30S ribosomal protein S20
 gi|184191758|gb|ACC69723.1| ribosomal protein S20 [Burkholderia phymatum STM815]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + +   +  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKYRTAVKAVRKAIEAGDAAQAAEIFKASAKTLDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+   A
Sbjct: 61 IADKKIVHKNKAARHKSRLAAAVKGLQAPA 90


>gi|54778773|gb|AAV39607.1| ribosomal protein S20 [synthetic construct]
          Length = 114

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 21  NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
           N SRRS +R+F++    AI  G    A +A  + + ++ +  +KG+ H N A+R  + L+
Sbjct: 45  NASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLT 104

Query: 81  ---KRLKGI 86
               +L GI
Sbjct: 105 AQINKLAGI 113


>gi|284048687|ref|YP_003399026.1| ribosomal protein S20 [Acidaminococcus fermentans DSM 20731]
 gi|283952908|gb|ADB47711.1| ribosomal protein S20 [Acidaminococcus fermentans DSM 20731]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  S+ + ++  A R   N   ++ +RS  R        G  EEA    + A S++ K
Sbjct: 1  MPNIKSSIRSVKTDAERRAANGPVKAEIRSTARKVEAFAAAGSKEEAQATLKVAASLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A  KG  +  AA+RK SRL+K++  +
Sbjct: 61 AARKGTVNKKAAARKKSRLAKKVNAV 86


>gi|149072055|ref|YP_001293554.1| 30S ribosomal protein s20 [Rhodomonas salina]
 gi|134303006|gb|ABO70810.1| 30S ribosomal protein s20 [Rhodomonas salina]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRK-----AE 55
          MAN  SA+K I+   R  L NK+ +S++++  +     I    + E+ +A        + 
Sbjct: 1  MANTKSAEKRIQINERNRLRNKAYKSAIKTIYKKC--LIAINDVNESNKATVNELLSLSY 58

Query: 56 SVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
          S I KA  KGI H N  + K S L+K LK +
Sbjct: 59 SKIDKAVQKGILHPNTGASKKSSLAKALKKV 89


>gi|269215623|ref|ZP_06159477.1| ribosomal protein S20 [Slackia exigua ATCC 700122]
 gi|269131110|gb|EEZ62185.1| ribosomal protein S20 [Slackia exigua ATCC 700122]
          Length = 97

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAIT----FGKIEEATEACRKAES 56
          MAN  S KK I    +  + NK+ +S +++ +R A EA+         + A  ACR    
Sbjct: 1  MANIKSQKKRILTNEKARMRNKAVKSELKTAVRAAREAVEAKDGVAAYKTALHACR---- 56

Query: 57 VIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          ++ KA SKGI H N A+ + S + K    I+T A
Sbjct: 57 LLDKAASKGIIHKNQAANRKSGVMKLANTIVTDA 90


>gi|237809692|ref|YP_002894132.1| 30S ribosomal protein S20 [Tolumonas auensis DSM 9187]
 gi|259494876|sp|C4LD15|RS20_TOLAT RecName: Full=30S ribosomal protein S20
 gi|237501953|gb|ACQ94546.1| ribosomal protein S20 [Tolumonas auensis DSM 9187]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS  R+F++    AI  G    A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAIQAEKARKHNASRRSMTRTFIKKVVAAIASGDKAVAQAAFAAAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  SRLS ++
Sbjct: 61 MATKGLIHKNKAARHKSRLSAQI 83


>gi|154686815|ref|YP_001421976.1| 30S ribosomal protein S20 [Bacillus amyloliquefaciens FZB42]
 gi|308174343|ref|YP_003921048.1| 30S ribosomal protein S20 (BS20) [Bacillus amyloliquefaciens DSM
          7]
 gi|166200013|sp|A7Z6W9|RS20_BACA2 RecName: Full=30S ribosomal protein S20
 gi|154352666|gb|ABS74745.1| RpsT [Bacillus amyloliquefaciens FZB42]
 gi|307607207|emb|CBI43578.1| ribosomal protein S20 (BS20) [Bacillus amyloliquefaciens DSM 7]
 gi|328554290|gb|AEB24782.1| 30S ribosomal protein S20 [Bacillus amyloliquefaciens TA208]
 gi|328912687|gb|AEB64283.1| 30S ribosomal protein S20 [Bacillus amyloliquefaciens LL3]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 11 IRKIARRTLINKSRR-------SSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKS 63
          I+   +RT  N  RR       S++R+ ++    ++   + ++A  A  +A   I KA  
Sbjct: 4  IKSAIKRTKTNNERRAHNATIKSAMRTAIKQVEASVANNEADKAKTALSEAAKRIDKAVK 63

Query: 64 KGIFHGNAASRKVSRLSKRLKGI 86
           G+ H NAA+R  SRL+K++ G+
Sbjct: 64 TGLVHKNAAARYKSRLAKQVNGL 86


>gi|322373101|ref|ZP_08047637.1| ribosomal protein S20 [Streptococcus sp. C150]
 gi|321278143|gb|EFX55212.1| ribosomal protein S20 [Streptococcus sp. C150]
          Length = 83

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S +R A +A      EEA    R A + I KA SKG+ H N ASR  SRL+ +L
Sbjct: 25 KNSAQKSALRTAIKAFNANPTEEA---FRAASASIDKAASKGLIHKNKASRDKSRLAAKL 81


>gi|312863119|ref|ZP_07723357.1| ribosomal protein S20 [Streptococcus vestibularis F0396]
 gi|311100655|gb|EFQ58860.1| ribosomal protein S20 [Streptococcus vestibularis F0396]
          Length = 78

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S +R A +A      EEA    R A + I KA SKG+ H N ASR  SRL+ +L
Sbjct: 20 KNSAQKSALRTAIKAFNANPTEEA---FRAASASIDKAASKGLIHKNKASRDKSRLAAKL 76


>gi|260424814|ref|ZP_05733377.2| ribosomal protein S20 [Dialister invisus DSM 15470]
 gi|260403278|gb|EEW96825.1| ribosomal protein S20 [Dialister invisus DSM 15470]
          Length = 94

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%)

Query: 50 ACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          A R+A+SVI  A  KGI H NAA+RK SRL+
Sbjct: 50 ALREAQSVIDTAARKGIIHKNAAARKKSRLN 80


>gi|213966170|ref|ZP_03394356.1| ribosomal protein S20 [Corynebacterium amycolatum SK46]
 gi|213951185|gb|EEB62581.1| ribosomal protein S20 [Corynebacterium amycolatum SK46]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 43/81 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L N++ RS+VR+ +R    A+  G    A    R A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNQAIRSAVRTEIRKFQAAVEAGDKAAAEAQLRVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A +KG+FH N A+ K S ++K
Sbjct: 61 AVTKGVFHRNTAANKKSGMAK 81


>gi|289434760|ref|YP_003464632.1| hypothetical protein lse_1395 [Listeria seeligeri serovar 1/2b
          str. SLCC3954]
 gi|289171004|emb|CBH27546.1| rpsT [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313633199|gb|EFS00077.1| ribosomal protein S20 [Listeria seeligeri FSL N1-067]
 gi|313637792|gb|EFS03142.1| ribosomal protein S20 [Listeria seeligeri FSL S4-171]
          Length = 84

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K ++    R   N S+RS++R+ ++  +EA T    + A +   +A   +  
Sbjct: 1  MPNINSAIKRVKTAETRKNRNASQRSAMRTAIKKFDEAAT-NNADNAKDLYVEASKKLDS 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+R  SRL+ +L
Sbjct: 60 AVSKGLIHKNNAARNKSRLAAKL 82


>gi|294506914|ref|YP_003570972.1| 30S ribosomal protein S20 [Salinibacter ruber M8]
 gi|116248196|sp|Q2S440|RS20_SALRD RecName: Full=30S ribosomal protein S20
 gi|294343242|emb|CBH24020.1| 30S ribosomal protein S20 [Salinibacter ruber M8]
          Length = 84

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M   +SAKK +R+  +R   NKS++S VR+ ++      +    EEA E     +  + +
Sbjct: 1  MPRHESAKKRMRQNEKRQKRNKSQKSRVRTKIKTLR---SLDDKEEAEELLNDVKGDLDR 57

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KGI H N A+ + S+L K +  +
Sbjct: 58 LAAKGIIHENKAANRKSKLEKHVDAL 83


>gi|294501310|ref|YP_003565010.1| 30S ribosomal protein S20 [Bacillus megaterium QM B1551]
 gi|294351247|gb|ADE71576.1| 30S ribosomal protein S20 [Bacillus megaterium QM B1551]
          Length = 88

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    R   N   +S++R+ +++    +    ++ A  A   A   + K
Sbjct: 1  MPNIKSAIKRVKTTEARRAHNIQAKSAMRTAIKNFEALVENNDVDNAKAAFAVASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   GI H NAA+R+ SRL+ +L G+
Sbjct: 61 AAQSGIIHKNAAARQKSRLAVKLNGL 86


>gi|170693519|ref|ZP_02884678.1| ribosomal protein S20 [Burkholderia graminis C4D1M]
 gi|170141674|gb|EDT09843.1| ribosomal protein S20 [Burkholderia graminis C4D1M]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E  + +   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDKAKAAEIFQASSKTIDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+   A
Sbjct: 61 IADKKIVHKNKAARHKSRLAAAIKGLQAPA 90


>gi|83815472|ref|YP_445041.1| ribosomal protein S20 [Salinibacter ruber DSM 13855]
 gi|83756866|gb|ABC44979.1| ribosomal protein S20 [Salinibacter ruber DSM 13855]
          Length = 106

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
           M   +SAKK +R+  +R   NKS++S VR+ ++      +    EEA E     +  + +
Sbjct: 23  MPRHESAKKRMRQNEKRQKRNKSQKSRVRTKIKTLR---SLDDKEEAEELLNDVKGDLDR 79

Query: 61  AKSKGIFHGNAASRKVSRLSKRLKGI 86
             +KGI H N A+ + S+L K +  +
Sbjct: 80  LAAKGIIHENKAANRKSKLEKHVDAL 105


>gi|260596441|ref|YP_003209012.1| 30S ribosomal protein S20 [Cronobacter turicensis z3032]
 gi|260215618|emb|CBA27880.1| 30S ribosomal protein S20 [Cronobacter turicensis z3032]
          Length = 93

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +
Sbjct: 7  LANIKSAKKRAVQSEKARKHNASRRSMMRTFVKKVYAAIEAGDKAAAQKAFNEMQPIVDR 66

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 67 QAAKGLIHKNKAARHKANLAAQI 89


>gi|224510721|pdb|3FIH|T Chain T, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 30s Subunit, Trnas And The Ternary
          Complex.
 gi|294662236|pdb|2WWL|T Chain T, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 30s, The P-Site
          Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387984|pdb|3OFO|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308388005|pdb|3OFP|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|309320042|pdb|3OFA|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 30s Subunit Of
          The First 70s Ribosome.
 gi|309320063|pdb|3OFB|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 30s Subunit Of
          The Second 70s Ribosome.
 gi|309320146|pdb|3OFX|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|309320167|pdb|3OFY|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome
 gi|315113631|pdb|3OAQ|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 30s Subunit Of
          The First 70s Ribosome.
 gi|315113652|pdb|3OAR|T Chain T, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 30s Subunit Of
          The Second 70s Ribosome
          Length = 85

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS +R+F++    AI  G    A +A  + + ++ +  +KG+ H N A+R  + L+
Sbjct: 19 NASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLT 78

Query: 81 KRL 83
           ++
Sbjct: 79 AQI 81


>gi|1173231|sp|P42275|RS20_PROMI RecName: Full=30S ribosomal protein S20
 gi|665952|gb|AAA87000.1| ribosomal protein S20 homolog [Proteus mirabilis]
          Length = 72

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRL 79
          N SRRS +R++++    A+  G  E A +A    + ++ +  +KG+ H N A+R  + L
Sbjct: 13 NASRRSMMRTYIKKVYAAVASGDKEAAQKAFNDMQPIVDRQATKGLIHKNKAARHKANL 71


>gi|33357897|pdb|1P6G|T Chain T, Real Space Refined Coordinates Of The 30s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
          State Of E. Coli 70s Ribosome
 gi|33357974|pdb|1P87|T Chain T, Real Space Refined Coordinates Of The 30s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The
          Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754058|pdb|2AVY|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 gi|83754114|pdb|2AW7|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 gi|118138072|pdb|2I2P|T Chain T, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|118138143|pdb|2I2U|T Chain T, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|157836040|pdb|2QOU|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836086|pdb|2QOW|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836144|pdb|2QOY|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836190|pdb|2QP0|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|158429717|pdb|2QAL|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429769|pdb|2QAN|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429827|pdb|2QB9|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429879|pdb|2QBB|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429931|pdb|2QBD|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          First 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429983|pdb|2QBF|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158430037|pdb|2QBH|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158430090|pdb|2QBJ|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431390|pdb|2Z4K|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Paromomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431443|pdb|2Z4M|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With
          Paromomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|168988807|pdb|2VHO|T Chain T, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 3 Of 4)
 gi|168988828|pdb|2VHP|T Chain T, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 4 Of 4)
 gi|197107297|pdb|3DF1|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|197107349|pdb|3DF3|T Chain T, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|329666011|pdb|3J00|T Chain T, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
          Length = 86

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS +R+F++    AI  G    A +A  + + ++ +  +KG+ H N A+R  + L+
Sbjct: 20 NASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLT 79

Query: 81 KRL 83
           ++
Sbjct: 80 AQI 82


>gi|51891614|ref|YP_074305.1| 30S ribosomal protein S20 [Symbiobacterium thermophilum IAM
          14863]
 gi|59798670|sp|Q67S82|RS20_SYMTH RecName: Full=30S ribosomal protein S20
 gi|51855303|dbj|BAD39461.1| 30S ribosomal protein S20 [Symbiobacterium thermophilum IAM
          14863]
          Length = 94

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK     A+RT  NK  +SS+R+ +R   EA+     E A     +A S + +
Sbjct: 1  MANTRSAKKRALVAAKRTARNKMVKSSLRTAIRKFREALG---TENAPILLNRAFSALDR 57

Query: 61 AKSKGIFHGN 70
          A SKG+ H N
Sbjct: 58 AASKGVIHKN 67


>gi|323359820|ref|YP_004226216.1| ribosomal protein S20 [Microbacterium testaceum StLB037]
 gi|323276191|dbj|BAJ76336.1| ribosomal protein S20 [Microbacterium testaceum StLB037]
          Length = 86

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S +++ +R   EA+  G  E A +A   A   + KA SKG+ H N A+ + S ++
Sbjct: 21 NKAVKSELKTHVRRTKEAVLAGDKEAAVKALATATKKLDKAVSKGVIHQNQAANRKSAIA 80

Query: 81 KRLKGI 86
          K +  +
Sbjct: 81 KSVAAL 86


>gi|172041035|ref|YP_001800749.1| 30S ribosomal protein S20 [Corynebacterium urealyticum DSM 7109]
 gi|226736476|sp|B1VGK8|RS20_CORU7 RecName: Full=30S ribosomal protein S20
 gi|171852339|emb|CAQ05315.1| 30S ribosomal protein S20 [Corynebacterium urealyticum DSM 7109]
          Length = 87

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 4/88 (4%)

Query: 1  MANKDSAKK--MIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
          MAN    KK  +  +IAR+   NK+ RS +R+  R  +  +  G  + A +  R A  + 
Sbjct: 1  MANIKQTKKRVLTNEIARQR--NKAVRSRLRTESRKFHALVEAGDKDAAEKQMRVAARLY 58

Query: 59 QKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           KA +KG+ H N A+ K SR++  L G+
Sbjct: 59 DKAVTKGVLHRNNAANKKSRMAAHLNGM 86


>gi|237746944|ref|ZP_04577424.1| small subunit ribosomal protein S20 [Oxalobacter formigenes
          HOxBLS]
 gi|229378295|gb|EEO28386.1| small subunit ribosomal protein S20 [Oxalobacter formigenes
          HOxBLS]
          Length = 90

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N S+RS++R+ ++ A +AI  G  E A     K  S I +
Sbjct: 1  MANTAQARKRARQAVKLNAHNSSQRSALRTAIKSAQKAIAAGDKEVAASVFVKTVSTIDR 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
             K   H N A+R  SRL
Sbjct: 61 IADKKRIHKNKAARHKSRL 79


>gi|116667429|pdb|2GY9|T Chain T, Structure Of The 30s Subunit Of A Pre-Translocational E.
          Coli Ribosome Obtained By Fitting Atomic Models For Rna
          And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667481|pdb|2GYB|T Chain T, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
          Ribosome Complex Obtained By Fitting Atomic Models For
          Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 83

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS +R+F++    AI  G    A +A  + + ++ +  +KG+ H N A+R  + L+
Sbjct: 17 NASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLT 76

Query: 81 KRL 83
           ++
Sbjct: 77 AQI 79


>gi|33241091|ref|NP_876033.1| 30S ribosomal protein S20 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
 gi|59798852|sp|Q7VA27|RS20_PROMA RecName: Full=30S ribosomal protein S20
 gi|33238620|gb|AAQ00686.1| Ribosomal protein S20 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
          Length = 99

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 9/92 (9%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRK------- 53
          MAN +SAKK I+   R  + N++ +S++R+ M+   EA      E+ +E  +K       
Sbjct: 1  MANNNSAKKRIQIAERNRIQNRTYKSAMRTLMKRCFEACG-AYSEKPSEDAKKDIQNSMN 59

Query: 54 -AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84
           A S I KA   G+ H N  + + SRL+  +K
Sbjct: 60 DAFSKIDKAVKTGVLHRNTGANQKSRLTSVVK 91


>gi|192359324|ref|YP_001981360.1| 30S ribosomal protein S20 [Cellvibrio japonicus Ueda107]
 gi|226736464|sp|B3PKU5|RS20_CELJU RecName: Full=30S ribosomal protein S20
 gi|190685489|gb|ACE83167.1| ribosomal protein S20 [Cellvibrio japonicus Ueda107]
          Length = 88

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   AKK  R+  +    N S RS  R++++    AI  G    A  A   A +VI +
Sbjct: 1  MANTPQAKKRARQNEKARKHNASMRSMGRTYLKKVLSAIQTGDQAAAQAAYVSAVAVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+ H N A+R  SRL+ +LK +
Sbjct: 61 IADKGLIHKNKAARHKSRLNAKLKAM 86


>gi|225868612|ref|YP_002744560.1| 30S ribosomal protein S20 [Streptococcus equi subsp.
          zooepidemicus]
 gi|225701888|emb|CAW99377.1| 30S ribosomal protein S20 [Streptococcus equi subsp.
          zooepidemicus]
          Length = 82

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPTEEL---FRAASSSIDKAQSKGLIHKNKASRDKARLAAKL 81


>gi|195978057|ref|YP_002123301.1| 30S ribosomal protein S20 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|195974762|gb|ACG62288.1| 30S ribosomal protein S20 RpsT [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
          Length = 80

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRTAIKAFEANPTEEL---FRAASSSIDKAQSKGLIHKNKASRDKARLAAKL 79


>gi|160944968|ref|ZP_02092194.1| hypothetical protein FAEPRAM212_02483 [Faecalibacterium
          prausnitzii M21/2]
 gi|158442699|gb|EDP19704.1| hypothetical protein FAEPRAM212_02483 [Faecalibacterium
          prausnitzii M21/2]
          Length = 86

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 23/29 (79%)

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKR 82
          A SVI KA++KG+   N ASRK+SR++KR
Sbjct: 53 AVSVIDKARAKGVIKKNTASRKISRMAKR 81


>gi|25028800|ref|NP_738854.1| 30S ribosomal protein S20 [Corynebacterium efficiens YS-314]
 gi|259507865|ref|ZP_05750765.1| 30S ribosomal protein S20 [Corynebacterium efficiens YS-314]
 gi|59798914|sp|Q8FNA1|RS20_COREF RecName: Full=30S ribosomal protein S20
 gi|23494086|dbj|BAC19054.1| putative 30S ribosomal protein S20 [Corynebacterium efficiens
          YS-314]
 gi|259164658|gb|EEW49212.1| 30S ribosomal protein S20 [Corynebacterium efficiens YS-314]
          Length = 87

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          L N++ RS+VR+ +R  + AI  G    A    R A   + KA +KG+FH N A+ K S 
Sbjct: 19 LRNQAIRSAVRTEIRKFHAAIDGGDKAAAESQLRVASRALDKAVTKGVFHRNNAANKKSS 78

Query: 79 LSK 81
          L++
Sbjct: 79 LAR 81


>gi|332670870|ref|YP_004453878.1| 30S ribosomal protein S20 [Cellulomonas fimi ATCC 484]
 gi|332339908|gb|AEE46491.1| ribosomal protein S20 [Cellulomonas fimi ATCC 484]
          Length = 86

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  L NK+ +S +++ +R   EA+  G  E A+ A   A   + K
Sbjct: 1  MANIKSQIKRIKTNEKARLRNKAVKSELKTHVRRVREAVAGGDKEAASTALAAASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
          A SKG+ H N A+ K S L+K
Sbjct: 61 AVSKGVIHANQAANKKSALAK 81


>gi|215400715|ref|YP_002327476.1| ribosomal protein S20 [Vaucheria litorea]
 gi|194441165|gb|ACF70893.1| ribosomal protein S20 [Vaucheria litorea]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEE-------ATEACRK 53
          MAN +SA K I+   R+   N   +S V+++++   + +   KI         A  A   
Sbjct: 1  MANNNSAIKRIKTSERKRKENLPYKSLVKTYIKKYFKTLEDLKIAPTKNNYINAKIALNL 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
            S I KAK K IFH N+A+RK S+L K L
Sbjct: 61 VFSKIDKAKKKNIFHKNSAARKKSKLMKAL 90


>gi|16329959|ref|NP_440687.1| 30S ribosomal protein S20 [Synechocystis sp. PCC 6803]
 gi|2500485|sp|P73336|RS20_SYNY3 RecName: Full=30S ribosomal protein S20
 gi|1652445|dbj|BAA17367.1| 30S ribosomal protein S20 [Synechocystis sp. PCC 6803]
          Length = 97

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-------TFGKIEEATEACRK 53
          MAN  SA K I    R  L NKS +S++++ M+   +++          K++    +   
Sbjct: 1  MANIKSALKRIEIAERNRLQNKSYKSAIKTLMKKTFQSVEAYASDPNPEKLDTINTSMAA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA    + H N A+RK +RL+K L+  L +A
Sbjct: 61 AFSKIDKAVKCKVIHKNNAARKKARLAKALQSALPAA 97


>gi|324531727|gb|ADY49185.1| 30S ribosomal protein S20 [Ascaris suum]
          Length = 117

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+   +  + N+  RS +R+ ++   E +   +I++A E        I K
Sbjct: 1  MANIKSQMKRIKTNEKARMRNRKIRSDLRTNIKKI-ETLIETEIKQAQEMLPTIYKKIDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKG 85
          A SKGI H N A+R  S +SK++ G
Sbjct: 60 AVSKGIIHQNKANRLKSNISKKVNG 84


>gi|319943169|ref|ZP_08017452.1| trigger factor [Lautropia mirabilis ATCC 51599]
 gi|319743711|gb|EFV96115.1| trigger factor [Lautropia mirabilis ATCC 51599]
          Length = 87

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +    N S RS +R+ ++   +A+  G  E A    R + SVI  
Sbjct: 1  MANIASARKRARQAVQLNAHNSSLRSRLRTAIKKVRKAVAAGDKEAAAAQFRASMSVIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H NAA+R  SRLS  +K +
Sbjct: 61 IADKKIIHKNAAARHKSRLSAAIKAM 86


>gi|315657201|ref|ZP_07910085.1| trigger factor [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492304|gb|EFU81911.1| trigger factor [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 102

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  S  K IR   +  L N S RS +++ +R   EAI  G    A    + A   +  
Sbjct: 16 LANIKSQIKRIRTNEKARLRNLSVRSELKTLVRKTREAIEAGDKAAAVANLKVATRHLDV 75

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+++ S+L+ R+
Sbjct: 76 AASKGVIHKNQAAQRKSKLATRV 98


>gi|269114875|ref|YP_003302638.1| 30S ribosomal protein S20 [Mycoplasma hominis]
 gi|268322500|emb|CAX37235.1| 30S ribosomal protein S20 [Mycoplasma hominis ATCC 23114]
          Length = 87

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S +K I    +  + N + +SSV++ ++ A  A    K  +A E    A   I K
Sbjct: 1  MANIKSKQKAILSNEKANIRNSAVKSSVKTAIKKAKIA-AVNKDPKAAEFQANAHHEIDK 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SKG+ H N  SRK SRL 
Sbjct: 60 AVSKGVLHQNNGSRKASRLD 79


>gi|298503157|ref|YP_003725097.1| 30S ribosomal protein S20 [Streptococcus pneumoniae TCH8431/19A]
 gi|307067434|ref|YP_003876400.1| hypothetical protein SPAP_0805 [Streptococcus pneumoniae AP200]
 gi|298238752|gb|ADI69883.1| 30S ribosomal protein S20 [Streptococcus pneumoniae TCH8431/19A]
 gi|306408971|gb|ADM84398.1| hypothetical protein SPAP_0805 [Streptococcus pneumoniae AP200]
          Length = 83

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSTKL 81


>gi|220905932|ref|YP_002481243.1| 30S ribosomal protein S20 [Cyanothece sp. PCC 7425]
 gi|254813108|sp|B8HTW2|RS20_CYAP4 RecName: Full=30S ribosomal protein S20
 gi|219862543|gb|ACL42882.1| ribosomal protein S20 [Cyanothece sp. PCC 7425]
          Length = 99

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAE----- 55
          MAN  SA K +    R  L NKS +S+V++  +   +A+       + +A + A+     
Sbjct: 1  MANIKSAIKRVEITERNRLHNKSYKSAVKTLTKKYFDAVAAYSASPSNDALQAAQTSLSA 60

Query: 56 --SVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            S I KA  +G+ H N  +RK +RL++ L   L +A
Sbjct: 61 AFSKIDKAVKRGVIHRNNGARKKARLARALNRHLANA 97


>gi|148997087|ref|ZP_01824741.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP11-BS70]
 gi|168575493|ref|ZP_02721429.1| ribosomal protein S20 [Streptococcus pneumoniae MLV-016]
 gi|194397721|ref|YP_002037473.1| 30S ribosomal protein S20 [Streptococcus pneumoniae G54]
 gi|221231623|ref|YP_002510775.1| 30S ribosomal protein S20 [Streptococcus pneumoniae ATCC 700669]
 gi|225854344|ref|YP_002735856.1| 30S ribosomal protein S20 [Streptococcus pneumoniae JJA]
 gi|225861266|ref|YP_002742775.1| 30S ribosomal protein S20 [Streptococcus pneumoniae Taiwan19F-14]
 gi|298231078|ref|ZP_06964759.1| 30S ribosomal protein S20 [Streptococcus pneumoniae str. Canada
          MDR_19F]
 gi|298254391|ref|ZP_06977977.1| 30S ribosomal protein S20 [Streptococcus pneumoniae str. Canada
          MDR_19A]
 gi|226695430|sp|B5E3L0|RS20_STRP4 RecName: Full=30S ribosomal protein S20
 gi|254813065|sp|B8ZNP0|RS20_STRPJ RecName: Full=30S ribosomal protein S20
 gi|254813067|sp|C1CDI5|RS20_STRZJ RecName: Full=30S ribosomal protein S20
 gi|254813069|sp|C1CS53|RS20_STRZT RecName: Full=30S ribosomal protein S20
 gi|147756787|gb|EDK63827.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP11-BS70]
 gi|183578641|gb|EDT99169.1| ribosomal protein S20 [Streptococcus pneumoniae MLV-016]
 gi|194357388|gb|ACF55836.1| ribosomal protein S20 [Streptococcus pneumoniae G54]
 gi|220674083|emb|CAR68599.1| 30S ribosomal protein S20 [Streptococcus pneumoniae ATCC 700669]
 gi|225722346|gb|ACO18199.1| ribosomal protein S20 [Streptococcus pneumoniae JJA]
 gi|225727162|gb|ACO23013.1| ribosomal protein S20 [Streptococcus pneumoniae Taiwan19F-14]
 gi|332076115|gb|EGI86581.1| ribosomal protein S20 [Streptococcus pneumoniae GA41301]
          Length = 78

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSTKL 76


>gi|1303800|dbj|BAA12456.1| YqeO [Bacillus subtilis]
          Length = 88

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K  +    R + N + +S++R+ ++    ++   + ++A  A  +A   I K
Sbjct: 1  MPNIKSAIKRTKTNNERGVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   G+ H N A+R  SRL+K++ G+
Sbjct: 61 AVKTGLVHKNTAARYKSRLAKKVNGL 86


>gi|157151412|ref|YP_001450365.1| 30S ribosomal protein S20 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|157076206|gb|ABV10889.1| ribosomal protein S20 [Streptococcus gordonii str. Challis
          substr. CH1]
          Length = 80

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRTAIKAFEANPTEEL---YRAASSAIDKAETKGLIHKNKASRDKARLAAKL 79


>gi|78484837|ref|YP_390762.1| ribosomal protein S20 [Thiomicrospira crunogena XCL-2]
 gi|118574568|sp|Q31ID5|RS20_THICR RecName: Full=30S ribosomal protein S20
 gi|78363123|gb|ABB41088.1| SSU ribosomal protein S20P [Thiomicrospira crunogena XCL-2]
          Length = 87

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A K  R+  +    N   R+++R+ ++    A+  G  E AT A R A+S +  
Sbjct: 1  MANSVQATKRARQAEKHRQHNAGMRAAMRTTVKKVLSAVEAGDKEAATAAFRVAQSSLDN 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KG+   N A+R  SR++ R+K +
Sbjct: 61 MARKGLIAKNKAARNKSRINARIKAM 86


>gi|153951103|ref|YP_001398892.1| 30S ribosomal protein S20 [Campylobacter jejuni subsp. doylei
          269.97]
 gi|166223923|sp|A7H5W2|RS20_CAMJD RecName: Full=30S ribosomal protein S20
 gi|152938549|gb|ABS43290.1| ribosomal protein S20 [Campylobacter jejuni subsp. doylei 269.97]
          Length = 87

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  ++T  N+  R+ +++  +   EA   G    A EA + A   I  
Sbjct: 1  MANHKSAEKRARQTIKKTERNRFYRTRLKNITKAVREAAANGDKNAANEALKVANKSIHA 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
            S G      ASR+VSRL+
Sbjct: 61 MVSHGFIKKQTASRRVSRLA 80


>gi|322385390|ref|ZP_08059035.1| 30S ribosomal protein S20 [Streptococcus cristatus ATCC 51100]
 gi|321270649|gb|EFX53564.1| 30S ribosomal protein S20 [Streptococcus cristatus ATCC 51100]
          Length = 83

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSAKL 81


>gi|81428677|ref|YP_395677.1| 30S ribosomal protein S20 [Lactobacillus sakei subsp. sakei 23K]
 gi|90111921|sp|Q38WR3|RS20_LACSS RecName: Full=30S ribosomal protein S20
 gi|78610319|emb|CAI55368.1| 30S Ribosomal protein S20 [Lactobacillus sakei subsp. sakei 23K]
          Length = 84

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K ++ I +    N S+ S++RS ++    A   G  EEA +  + A   I  A +KG
Sbjct: 6  SAMKRVKTIEKANNRNASQLSTMRSAIKKFKAAQAAGN-EEAADLLKAATRAIDMASTKG 64

Query: 66 IFHGNAASRKVSRLSKRL 83
          + H N A R  SRL+K +
Sbjct: 65 LIHANKAGRDKSRLNKMM 82


>gi|317485412|ref|ZP_07944291.1| ribosomal protein S20 [Bilophila wadsworthia 3_1_6]
 gi|316923371|gb|EFV44578.1| ribosomal protein S20 [Bilophila wadsworthia 3_1_6]
          Length = 90

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  ++  +R   N++ ++ +++ ++    AI       AT+    A S + K
Sbjct: 1  MANHKSAIKRHKQSVKRAARNRTVKTRIKNVVKSVRAAIKADDQAAATQLLSTATSSLDK 60

Query: 61 AKSKGIFHGNAASRKVSR 78
          A +KG+ H   A+RK+SR
Sbjct: 61 AATKGVIHWKKAARKISR 78


>gi|262282352|ref|ZP_06060120.1| ribosomal protein S20 [Streptococcus sp. 2_1_36FAA]
 gi|262261643|gb|EEY80341.1| ribosomal protein S20 [Streptococcus sp. 2_1_36FAA]
          Length = 82

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPTEEL---YRAASSAIDKAETKGLIHKNKASRDKARLAAKL 81


>gi|665950|gb|AAA87001.1| ribosomal protein S20 homolog [Salmonella enterica subsp.
          enterica serovar Typhimurium]
          Length = 72

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS +R+F++    AI  G    A +A  + + ++ +  +KG+ H N A+R  + L+
Sbjct: 13 NASRRSMMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLT 72


>gi|15900725|ref|NP_345329.1| 30S ribosomal protein S20 [Streptococcus pneumoniae TIGR4]
 gi|148990345|ref|ZP_01821531.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP6-BS73]
 gi|168490926|ref|ZP_02715069.1| ribosomal protein S20 [Streptococcus pneumoniae CDC0288-04]
 gi|17865582|sp|Q97RH7|RS20_STRPN RecName: Full=30S ribosomal protein S20
 gi|14972311|gb|AAK74969.1| ribosomal protein S20 [Streptococcus pneumoniae TIGR4]
 gi|147924374|gb|EDK75465.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP6-BS73]
 gi|183574606|gb|EDT95134.1| ribosomal protein S20 [Streptococcus pneumoniae CDC0288-04]
 gi|332204842|gb|EGJ18907.1| ribosomal protein S20 [Streptococcus pneumoniae GA47901]
          Length = 78

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSAKL 76


>gi|116515680|ref|YP_816224.1| 30S ribosomal protein S20 [Streptococcus pneumoniae D39]
 gi|148986066|ref|ZP_01819087.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP3-BS71]
 gi|148992504|ref|ZP_01822199.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP9-BS68]
 gi|149004041|ref|ZP_01828847.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP14-BS69]
 gi|149007222|ref|ZP_01830886.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP18-BS74]
 gi|149010534|ref|ZP_01831905.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP19-BS75]
 gi|149021702|ref|ZP_01835733.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP23-BS72]
 gi|161410750|ref|NP_358334.2| 30S ribosomal protein S20 [Streptococcus pneumoniae R6]
 gi|168484726|ref|ZP_02709678.1| ribosomal protein S20 [Streptococcus pneumoniae CDC1873-00]
 gi|168485784|ref|ZP_02710292.1| ribosomal protein S20 [Streptococcus pneumoniae CDC1087-00]
 gi|168489789|ref|ZP_02713988.1| ribosomal protein S20 [Streptococcus pneumoniae SP195]
 gi|168492991|ref|ZP_02717134.1| ribosomal protein S20 [Streptococcus pneumoniae CDC3059-06]
 gi|169833201|ref|YP_001694292.1| 30S ribosomal protein S20 [Streptococcus pneumoniae Hungary19A-6]
 gi|225856504|ref|YP_002738015.1| 30S ribosomal protein S20 [Streptococcus pneumoniae P1031]
 gi|225858638|ref|YP_002740148.1| 30S ribosomal protein S20 [Streptococcus pneumoniae 70585]
 gi|237650827|ref|ZP_04525079.1| 30S ribosomal protein S20 [Streptococcus pneumoniae CCRI 1974]
 gi|237821567|ref|ZP_04597412.1| 30S ribosomal protein S20 [Streptococcus pneumoniae CCRI 1974M2]
 gi|303254026|ref|ZP_07340144.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS455]
 gi|303260299|ref|ZP_07346270.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP-BS293]
 gi|303261505|ref|ZP_07347453.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP14-BS292]
 gi|303264173|ref|ZP_07350094.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS397]
 gi|303267039|ref|ZP_07352911.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS457]
 gi|303269199|ref|ZP_07354976.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS458]
 gi|307127613|ref|YP_003879644.1| 30S ribosomal protein S20 [Streptococcus pneumoniae 670-6B]
 gi|307703579|ref|ZP_07640521.1| ribosomal protein S20 [Streptococcus oralis ATCC 35037]
 gi|307706391|ref|ZP_07643203.1| ribosomal protein S20 [Streptococcus mitis SK321]
 gi|307708532|ref|ZP_07644997.1| ribosomal protein S20 [Streptococcus mitis NCTC 12261]
 gi|307709014|ref|ZP_07645474.1| ribosomal protein S20 [Streptococcus mitis SK564]
 gi|322375419|ref|ZP_08049932.1| ribosomal protein S20 [Streptococcus sp. C300]
 gi|322376390|ref|ZP_08050883.1| ribosomal protein S20 [Streptococcus sp. M334]
 gi|331266180|ref|YP_004325810.1| 30S ribosomal protein S20 [Streptococcus oralis Uo5]
 gi|59798899|sp|Q8CWS0|RS20_STRR6 RecName: Full=30S ribosomal protein S20
 gi|122278890|sp|Q04L74|RS20_STRP2 RecName: Full=30S ribosomal protein S20
 gi|226695431|sp|B1IB07|RS20_STRPI RecName: Full=30S ribosomal protein S20
 gi|254813064|sp|C1C6H2|RS20_STRP7 RecName: Full=30S ribosomal protein S20
 gi|254813068|sp|C1CJS7|RS20_STRZP RecName: Full=30S ribosomal protein S20
 gi|116076256|gb|ABJ53976.1| ribosomal protein S20 [Streptococcus pneumoniae D39]
 gi|147757942|gb|EDK64950.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP14-BS69]
 gi|147761260|gb|EDK68227.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP18-BS74]
 gi|147765015|gb|EDK71944.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP19-BS75]
 gi|147921900|gb|EDK73026.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP3-BS71]
 gi|147928821|gb|EDK79834.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP9-BS68]
 gi|147930163|gb|EDK81149.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP23-BS72]
 gi|168995703|gb|ACA36315.1| ribosomal protein S20 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042109|gb|EDT50155.1| ribosomal protein S20 [Streptococcus pneumoniae CDC1873-00]
 gi|183571039|gb|EDT91567.1| ribosomal protein S20 [Streptococcus pneumoniae CDC1087-00]
 gi|183571791|gb|EDT92319.1| ribosomal protein S20 [Streptococcus pneumoniae SP195]
 gi|183576932|gb|EDT97460.1| ribosomal protein S20 [Streptococcus pneumoniae CDC3059-06]
 gi|225720543|gb|ACO16397.1| ribosomal protein S20 [Streptococcus pneumoniae 70585]
 gi|225725067|gb|ACO20919.1| ribosomal protein S20 [Streptococcus pneumoniae P1031]
 gi|301793978|emb|CBW36376.1| 30S ribosomal protein S20 [Streptococcus pneumoniae INV104]
 gi|301799835|emb|CBW32407.1| 30S ribosomal protein S20 [Streptococcus pneumoniae OXC141]
 gi|301801666|emb|CBW34368.1| 30S ribosomal protein S20 [Streptococcus pneumoniae INV200]
 gi|302599006|gb|EFL66034.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS455]
 gi|302637639|gb|EFL68126.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP14-BS292]
 gi|302638623|gb|EFL69087.1| 30S ribosomal protein S20 [Streptococcus pneumoniae SP-BS293]
 gi|302641263|gb|EFL71633.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS458]
 gi|302643433|gb|EFL73708.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS457]
 gi|302646578|gb|EFL76804.1| 30S ribosomal protein S20 [Streptococcus pneumoniae BS397]
 gi|306484675|gb|ADM91544.1| ribosomal protein S20 [Streptococcus pneumoniae 670-6B]
 gi|307615448|gb|EFN94656.1| ribosomal protein S20 [Streptococcus mitis NCTC 12261]
 gi|307618309|gb|EFN97464.1| ribosomal protein S20 [Streptococcus mitis SK321]
 gi|307620350|gb|EFN99466.1| ribosomal protein S20 [Streptococcus mitis SK564]
 gi|307622986|gb|EFO01981.1| ribosomal protein S20 [Streptococcus oralis ATCC 35037]
 gi|321279682|gb|EFX56722.1| ribosomal protein S20 [Streptococcus sp. C300]
 gi|321282197|gb|EFX59204.1| ribosomal protein S20 [Streptococcus sp. M334]
 gi|326682852|emb|CBZ00469.1| 30S ribosomal protein S20 [Streptococcus oralis Uo5]
 gi|327390189|gb|EGE88532.1| ribosomal protein S20 [Streptococcus pneumoniae GA04375]
 gi|332073165|gb|EGI83644.1| ribosomal protein S20 [Streptococcus pneumoniae GA17570]
 gi|332077249|gb|EGI87711.1| ribosomal protein S20 [Streptococcus pneumoniae GA17545]
 gi|332202692|gb|EGJ16761.1| ribosomal protein S20 [Streptococcus pneumoniae GA41317]
 gi|332203988|gb|EGJ18055.1| ribosomal protein S20 [Streptococcus pneumoniae GA47368]
          Length = 78

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSAKL 76


>gi|166240831|ref|ZP_02240703.1| 30S ribosomal protein S20 [Paenibacillus larvae subsp. larvae
          BRL-230010]
          Length = 75

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++   +R L N S++S +R+ ++     +   +++ A EA   A   + K
Sbjct: 1  MPNIKSAIKRVKVSDKRRLRNASQKSDLRTAIKAFETVVARKRVDSAKEAFVVASKKLDK 60

Query: 61 AKSKGIFHGNAASR 74
          A SKG+ H N A+R
Sbjct: 61 AASKGLIHKNVANR 74


>gi|160902830|ref|YP_001568411.1| ribosomal protein S20 [Petrotoga mobilis SJ95]
 gi|189044874|sp|A9BHX3|RS20_PETMO RecName: Full=30S ribosomal protein S20
 gi|160360474|gb|ABX32088.1| ribosomal protein S20 [Petrotoga mobilis SJ95]
          Length = 100

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAI-TFGKIEEATEACRKAESVIQ 59
          M NK SA+K +R+  +R   N+  +  ++   +  ++ I    + EE  +   K+  +I 
Sbjct: 1  MPNKKSAEKRVRQSEQRRQKNRGYQKRIKEISKEIDKKIHENAEREELMQLLSKSFKIID 60

Query: 60 KAKSKGIFHGNAASRKVSRLSKRLKGIL 87
           AKS G  H N A+RK S+L  ++K  L
Sbjct: 61 TAKSHGAVHKNYAARKKSKLHLKVKKYL 88


>gi|182683750|ref|YP_001835497.1| 30S ribosomal protein S20 [Streptococcus pneumoniae CGSP14]
 gi|270292557|ref|ZP_06198768.1| ribosomal protein S20 [Streptococcus sp. M143]
 gi|289167729|ref|YP_003445998.1| 30S ribosomal protein S20 [Streptococcus mitis B6]
 gi|293365630|ref|ZP_06612339.1| 30S ribosomal protein S20 [Streptococcus oralis ATCC 35037]
 gi|306825045|ref|ZP_07458387.1| 30S ribosomal protein S20 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306829683|ref|ZP_07462873.1| 30S ribosomal protein S20 [Streptococcus mitis ATCC 6249]
 gi|315613346|ref|ZP_07888255.1| 30S ribosomal protein S20 [Streptococcus sanguinis ATCC 49296]
 gi|15458333|gb|AAK99544.1| 30S Ribosomal protein subunit S20 [Streptococcus pneumoniae R6]
 gi|182629084|gb|ACB90032.1| 30S ribosomal protein S20 [Streptococcus pneumoniae CGSP14]
 gi|270278536|gb|EFA24382.1| ribosomal protein S20 [Streptococcus sp. M143]
 gi|288907296|emb|CBJ22131.1| 30S ribosomal protein S20 [Streptococcus mitis B6]
 gi|291315998|gb|EFE56442.1| 30S ribosomal protein S20 [Streptococcus oralis ATCC 35037]
 gi|304428769|gb|EFM31859.1| 30S ribosomal protein S20 [Streptococcus mitis ATCC 6249]
 gi|304432481|gb|EFM35455.1| 30S ribosomal protein S20 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|315314581|gb|EFU62624.1| 30S ribosomal protein S20 [Streptococcus sanguinis ATCC 49296]
          Length = 83

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSAKL 81


>gi|111657490|ref|ZP_01408236.1| hypothetical protein SpneT_02001315 [Streptococcus pneumoniae
          TIGR4]
          Length = 83

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSAKL 81


>gi|221310479|ref|ZP_03592326.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221314803|ref|ZP_03596608.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. subtilis str.
          NCIB 3610]
 gi|221319725|ref|ZP_03601019.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. subtilis str.
          JH642]
 gi|221324003|ref|ZP_03605297.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. subtilis str.
          SMY]
 gi|255767588|ref|NP_390433.2| 30S ribosomal protein S20 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|321312039|ref|YP_004204326.1| 30S ribosomal protein S20 [Bacillus subtilis BSn5]
 gi|251757503|sp|P21477|RS20_BACSU RecName: Full=30S ribosomal protein S20; Short=BS20
 gi|225185216|emb|CAB14497.2| ribosomal protein S20 (BS20) [Bacillus subtilis subsp. subtilis
          str. 168]
 gi|291485003|dbj|BAI86078.1| 30S ribosomal protein S20 [Bacillus subtilis subsp. natto
          BEST195]
 gi|320018313|gb|ADV93299.1| 30S ribosomal protein S20 [Bacillus subtilis BSn5]
          Length = 88

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K  +    R + N + +S++R+ ++    ++   + ++A  A  +A   I K
Sbjct: 1  MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   G+ H N A+R  SRL+K++ G+
Sbjct: 61 AVKTGLVHKNTAARYKSRLAKKVNGL 86


>gi|291613493|ref|YP_003523650.1| ribosomal protein S20 [Sideroxydans lithotrophicus ES-1]
 gi|291583605|gb|ADE11263.1| ribosomal protein S20 [Sideroxydans lithotrophicus ES-1]
          Length = 87

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  ++  ++   N S RS +R+ ++   +AI  G    A    +++ SV+  
Sbjct: 1  MANSAQARKRAKQAVKQGQHNASLRSELRTAIKKVAKAIEAGDKAAAQAVFQESTSVVDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIVHKNKAARHKSRLSAAIKAM 86


>gi|116329270|ref|YP_798990.1| 30S ribosomal protein S20 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|122282949|sp|Q04XY8|RS20_LEPBL RecName: Full=30S ribosomal protein S20
 gi|116122014|gb|ABJ80057.1| 30S Ribosomal protein S20 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
          Length = 90

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S++K IR+  RR   N   RS +R+  +   +AI     + A     +  S + K
Sbjct: 1  MANIKSSEKDIRRTKRRNAANSQNRSRLRTQAKKILKAIKEKDPKAAMALFIEYTSFLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A    + H   A RK SR++KRL  +  +A
Sbjct: 61 AAKTNLIHSKNADRKKSRMAKRLNAVSAAA 90


>gi|116627668|ref|YP_820287.1| 30S ribosomal protein S20 [Streptococcus thermophilus LMD-9]
 gi|161611287|ref|YP_139292.2| 30S ribosomal protein S20 [Streptococcus thermophilus LMG 18311]
 gi|161936370|ref|YP_141206.2| 30S ribosomal protein S20 [Streptococcus thermophilus CNRZ1066]
 gi|122267735|sp|Q03L31|RS20_STRTD RecName: Full=30S ribosomal protein S20
 gi|116100945|gb|ABJ66091.1| SSU ribosomal protein S20P [Streptococcus thermophilus LMD-9]
 gi|221047226|gb|ACL98065.1| 30S ribosomal protein S20 [Streptococcus thermophilus]
 gi|312278191|gb|ADQ62848.1| 30S ribosomal protein S20 [Streptococcus thermophilus ND03]
          Length = 78

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K      ++   N +++S++R+ ++       F K     EA R A + I K
Sbjct: 1  MANIKSAIKRAELNVKQNEKNSAQKSALRTVIK------AF-KANPTEEAFRAASASIDK 53

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N ASR  SRL+ +L
Sbjct: 54 AASKGLIHKNKASRDKSRLAAKL 76


>gi|125717864|ref|YP_001034997.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK36]
 gi|323351705|ref|ZP_08087359.1| 30S ribosomal protein S20 [Streptococcus sanguinis VMC66]
 gi|166223993|sp|A3CMP2|RS20_STRSV RecName: Full=30S ribosomal protein S20
 gi|125497781|gb|ABN44447.1| 30S ribosomal protein subunit S20, putative [Streptococcus
          sanguinis SK36]
 gi|322122191|gb|EFX93917.1| 30S ribosomal protein S20 [Streptococcus sanguinis VMC66]
 gi|324990802|gb|EGC22737.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK353]
 gi|325689833|gb|EGD31837.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK115]
 gi|325694370|gb|EGD36282.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK150]
 gi|327459753|gb|EGF06093.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK1057]
 gi|327469476|gb|EGF14945.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK330]
 gi|327489170|gb|EGF20963.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK1058]
 gi|328946009|gb|EGG40155.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK1087]
 gi|332360341|gb|EGJ38153.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK49]
 gi|332360924|gb|EGJ38729.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK355]
 gi|332361390|gb|EGJ39194.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK1056]
          Length = 78

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLSAKL 76


>gi|91776563|ref|YP_546319.1| 30S ribosomal protein S20 [Methylobacillus flagellatus KT]
 gi|118573826|sp|Q1GZ59|RS20_METFK RecName: Full=30S ribosomal protein S20
 gi|91710550|gb|ABE50478.1| SSU ribosomal protein S20P [Methylobacillus flagellatus KT]
          Length = 87

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS++R+ ++   +A+  G    A     +  SVI +
Sbjct: 1  MANSAQARKRARQAVKQRAHNASLRSALRTAIKKIIKAVEAGDKTAAQSVFNENVSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIIHKNKAARHKSRLSAAIKAL 86


>gi|257869954|ref|ZP_05649607.1| ribosomal protein S20 [Enterococcus gallinarum EG2]
 gi|257804118|gb|EEV32940.1| ribosomal protein S20 [Enterococcus gallinarum EG2]
          Length = 84

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N +SA K +R        N S+ S++R+ ++  + A+  G  +      + A   I  
Sbjct: 1  MPNIESAIKRVRTSEAANAKNSSQVSTMRTAIKKFDLAVEAG-ADNVDALYKDAVKAIDM 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A++KG+ H N ASR  SRLSK++
Sbjct: 60 AETKGLIHKNKASRDKSRLSKKI 82


>gi|310822826|ref|YP_003955184.1| 30S ribosomal protein S20 [Stigmatella aurantiaca DW4/3-1]
 gi|309395898|gb|ADO73357.1| 30S ribosomal protein S20 [Stigmatella aurantiaca DW4/3-1]
          Length = 65

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 33/55 (60%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRL 79
          R++V++ ++ A E +      ++ +A + A   + KA SKGI H   A+R+++RL
Sbjct: 2  RTTVKNAVKKARETLATKDTAKSADAVKDATRTLAKAASKGILHPRNAARRIARL 56


>gi|315654878|ref|ZP_07907783.1| trigger factor [Mobiluncus curtisii ATCC 51333]
 gi|315490839|gb|EFU80459.1| trigger factor [Mobiluncus curtisii ATCC 51333]
          Length = 102

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  S  K IR   +  L N S RS +++ +R   EAI  G    A    + A   +  
Sbjct: 16 LANIKSQIKRIRTNEKARLRNLSVRSELKTLVRKTREAIEAGDKAAAEANLKVATRHLDV 75

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+++ S+L+ R+
Sbjct: 76 AASKGVIHKNQAAQRKSKLATRV 98


>gi|113953187|ref|YP_731558.1| 30S ribosomal protein S20 [Synechococcus sp. CC9311]
 gi|123132406|sp|Q0I7L4|RS20_SYNS3 RecName: Full=30S ribosomal protein S20
 gi|113880538|gb|ABI45496.1| ribosomal protein S20 [Synechococcus sp. CC9311]
          Length = 99

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRH---ANEAITFGKIEEA----TEACRK 53
          MAN  S+KK +    R  L NK+ +S++R+ M+    A  A      +EA    T +   
Sbjct: 1  MANNKSSKKRVEIGERNRLQNKAYKSALRTLMKRCFTACSAYIEAPGDEAKTTLTTSLNA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLS 80
          A S I KA  +G+ H NA + + SRLS
Sbjct: 61 AFSKIDKAVKRGVMHRNAGAHQKSRLS 87


>gi|15673721|ref|NP_267895.1| 30S ribosomal protein S20 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|281492330|ref|YP_003354310.1| 50S ribosomal protein S20P [Lactococcus lactis subsp. lactis
          KF147]
 gi|17865592|sp|Q9CEU5|RS20_LACLA RecName: Full=30S ribosomal protein S20
 gi|12724759|gb|AAK05837.1|AE006404_4 30S ribosomal protein S20 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|281375994|gb|ADA65485.1| SSU ribosomal protein S20P [Lactococcus lactis subsp. lactis
          KF147]
 gi|326407223|gb|ADZ64294.1| 30S ribosomal protein S20 [Lactococcus lactis subsp. lactis CV56]
          Length = 77

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N  ++S++R+ ++    A T        E  R A S I KA SKG+ H N ASR  +RL+
Sbjct: 21 NAQQKSAMRTLIKKFEAAPT-------EELYRAASSSIDKAASKGLIHANKASRDKARLA 73

Query: 81 KRL 83
           +L
Sbjct: 74 AKL 76


>gi|21230610|ref|NP_636527.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66769394|ref|YP_244156.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|188992581|ref|YP_001904591.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. campestris
          str. B100]
 gi|325920795|ref|ZP_08182696.1| SSU ribosomal protein S20P [Xanthomonas gardneri ATCC 19865]
 gi|23822132|sp|Q8PBG9|RS20_XANCP RecName: Full=30S ribosomal protein S20
 gi|81304649|sp|Q4US37|RS20_XANC8 RecName: Full=30S ribosomal protein S20
 gi|226695441|sp|B0RY31|RS20_XANCB RecName: Full=30S ribosomal protein S20
 gi|21112191|gb|AAM40451.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66574726|gb|AAY50136.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|167734341|emb|CAP52551.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. campestris]
 gi|325548692|gb|EGD19645.1| SSU ribosomal protein S20P [Xanthomonas gardneri ATCC 19865]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++   R   N  +RS +R+ ++   +A+       A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAKQTVVRNERNTGQRSMLRTAVKKVIKALDANDAAGAEAAFAVAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+R  SRL+ R+K I
Sbjct: 61 FSARGLIHKNKAARHKSRLTARIKAI 86


>gi|322516992|ref|ZP_08069881.1| 30S ribosomal protein S20 [Streptococcus vestibularis ATCC 49124]
 gi|322124409|gb|EFX95906.1| 30S ribosomal protein S20 [Streptococcus vestibularis ATCC 49124]
          Length = 51

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 32 MRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          MR A +A      EEA    R A + I KA SKG+ H N ASR  SRL+ +L
Sbjct: 1  MRTAIKAFNANPTEEA---FRAASASIDKAASKGLIHKNKASRDKSRLAAKL 49


>gi|116512592|ref|YP_811499.1| 30S ribosomal protein S20 [Lactococcus lactis subsp. cremoris
          SK11]
 gi|125624703|ref|YP_001033186.1| 30S ribosomal protein S20 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|123025246|sp|Q02XD6|RS20_LACLS RecName: Full=30S ribosomal protein S20
 gi|226736511|sp|A2RMG0|RS20_LACLM RecName: Full=30S ribosomal protein S20
 gi|116108246|gb|ABJ73386.1| SSU ribosomal protein S20P [Lactococcus lactis subsp. cremoris
          SK11]
 gi|124493511|emb|CAL98490.1| 30S ribosomal protein S20 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|300071498|gb|ADJ60898.1| 30S ribosomal protein S20 [Lactococcus lactis subsp. cremoris
          NZ9000]
          Length = 77

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEAT--EACRKAESVIQKAKSKGIFHGNAASRKVSR 78
          N  ++S++R+ ++         K E A   E  R A S I KA SKG+ H N ASR  +R
Sbjct: 21 NAQQKSAMRTLIK---------KFEAAPSEELYRAASSTIDKAASKGLIHANKASRDKAR 71

Query: 79 LSKRL 83
          L+ +L
Sbjct: 72 LAAKL 76


>gi|298346285|ref|YP_003718972.1| 30S ribosomal protein S20 [Mobiluncus curtisii ATCC 43063]
 gi|304389949|ref|ZP_07371906.1| 30S ribosomal protein S20 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|298236346|gb|ADI67478.1| 30S ribosomal protein S20 [Mobiluncus curtisii ATCC 43063]
 gi|304326842|gb|EFL94083.1| 30S ribosomal protein S20 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
          Length = 102

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          +AN  S  K IR   +  L N S RS +++ +R   EAI  G    A    + A   +  
Sbjct: 16 LANIKSQIKRIRTNEKARLRNLSVRSELKTLVRKTREAIEAGDKAAAEANLKVATRHLDV 75

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A SKG+ H N A+++ S+L+ R+
Sbjct: 76 AASKGVIHKNQAAQRKSKLATRV 98


>gi|295706657|ref|YP_003599732.1| 30S ribosomal protein S20 [Bacillus megaterium DSM 319]
 gi|294804316|gb|ADF41382.1| 30S ribosomal protein S20 [Bacillus megaterium DSM 319]
          Length = 88

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    R   N   +S++R+ +++    +    ++ A  A   A   + K
Sbjct: 1  MPNIKSAIKRVKTTEARRAHNIQAKSAMRTAIKNFEALVENNDVDNAKAAFAVASKKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A   G+ H NAA+R+ SRL+ +L G+
Sbjct: 61 AAQSGLIHKNAAARQKSRLAVKLNGL 86


>gi|158336722|ref|YP_001517896.1| 30S ribosomal protein S20 [Acaryochloris marina MBIC11017]
 gi|189044846|sp|B0C2C8|RS20_ACAM1 RecName: Full=30S ribosomal protein S20
 gi|158306963|gb|ABW28580.1| 30S ribosomal protein S20 [Acaryochloris marina MBIC11017]
          Length = 94

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 47/92 (51%), Gaps = 7/92 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE---ACRKAESV 57
          MAN  SAKK I    R  L NK+ +S++++F +    A+   K   + +   A +   SV
Sbjct: 1  MANIKSAKKRILIAERNRLQNKAYKSAIKTFTKRFQAAVDDYKSNPSDDQLAAIQNEMSV 60

Query: 58 ----IQKAKSKGIFHGNAASRKVSRLSKRLKG 85
              I KA   G+FH N  +RK + L++ LK 
Sbjct: 61 TYSKIDKAVKVGVFHRNTGARKKAGLARILKA 92


>gi|311748302|ref|ZP_07722087.1| ribosomal protein S20 [Algoriphagus sp. PR1]
 gi|126576799|gb|EAZ81047.1| ribosomal protein S20 [Algoriphagus sp. PR1]
          Length = 84

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K IR    + L N+ +  + R+F++      T  K+E A E  +K  S++ K
Sbjct: 1  MANHKSALKRIRANEAKRLRNRYQAKTTRTFIKKL--KATTDKVE-ANELYKKVVSMLDK 57

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
             K + H N A+ K SRL+K
Sbjct: 58 LAKKNVIHKNNANNKKSRLAK 78


>gi|62510982|sp|Q5M080|RS20_STRT1 RecName: Full=30S ribosomal protein S20
 gi|62510984|sp|Q5M4T9|RS20_STRT2 RecName: Full=30S ribosomal protein S20
 gi|55736835|gb|AAV60477.1| 30S ribosomal protein S20 [Streptococcus thermophilus LMG 18311]
 gi|55738750|gb|AAV62391.1| 30S ribosomal protein S20 [Streptococcus thermophilus CNRZ1066]
          Length = 83

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N +++S++R+ ++       F K     EA R A + I KA SKG+ H N ASR  SRL+
Sbjct: 26 NSAQKSALRTVIK------AF-KANPTEEAFRAASASIDKAASKGLIHKNKASRDKSRLA 78

Query: 81 KRL 83
           +L
Sbjct: 79 AKL 81


>gi|309811284|ref|ZP_07705073.1| ribosomal protein S20 [Dermacoccus sp. Ellin185]
 gi|308434766|gb|EFP58609.1| ribosomal protein S20 [Dermacoccus sp. Ellin185]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I+    RT  NK+ +S +R+++R     +  G  + A+ A   A   + K
Sbjct: 1  MANIKSQMKRIKTNEIRTERNKAYKSELRTWIRKFRAEVEAGNKDAASTALAAASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ K S ++K+L  I
Sbjct: 61 AVSKGVIHKNQAANKKSAMAKQLNQI 86


>gi|284929147|ref|YP_003421669.1| 30S ribosomal protein S20P [cyanobacterium UCYN-A]
 gi|284809606|gb|ADB95311.1| SSU ribosomal protein S20P [cyanobacterium UCYN-A]
          Length = 97

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATE-------ACRK 53
          MAN  SA K I+   R  L NKS  S+V++ M+   +A+        T+       +   
Sbjct: 1  MANSKSAIKRIQIAERNRLRNKSYSSAVKTLMKKYFQAVENYAAAPTTDNKAIVEKSMSA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA  + + H N  +RK +RL+K L+ ++  +
Sbjct: 61 AYSKIDKAVKRSVLHRNNGARKKARLAKFLQKVVPDS 97


>gi|331695854|ref|YP_004332093.1| 30S ribosomal protein S20 [Pseudonocardia dioxanivorans CB1190]
 gi|326950543|gb|AEA24240.1| 30S ribosomal protein S20 [Pseudonocardia dioxanivorans CB1190]
          Length = 91

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 50/89 (56%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K ++   +R   NK+ +SSVR+ +R   EA   G+ E+A E  R A   + K
Sbjct: 1  MANIKSQIKRVKTNEKRRQRNKAVKSSVRTAIRRFREAAEAGETEKAVELQRAAAKALDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
          A SKG+ H N A+ + S +++R   + +S
Sbjct: 61 AASKGVIHRNQAANRKSAIARRAHALSSS 89


>gi|119953029|ref|YP_945238.1| 30S ribosomal protein S20 [Borrelia turicatae 91E135]
 gi|254813048|sp|A1QZ26|RS20_BORT9 RecName: Full=30S ribosomal protein S20
 gi|119861800|gb|AAX17568.1| SSU ribosomal protein S20P [Borrelia turicatae 91E135]
          Length = 85

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K  R+  +R L N S +S +++  +     I  GK EEA E  +     +  
Sbjct: 1  MGNNPSALKRARQNLKRNLRNVSVKSELKTIEKRCMNLIREGKKEEALEFFKFVSKKLDT 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  K I H N A+RK S LS
Sbjct: 61 AARKRIIHRNKAARKKSNLS 80


>gi|222823062|ref|YP_002574635.1| 30S ribosomal protein S20 [Campylobacter lari RM2100]
 gi|254813054|sp|B9KE99|RS20_CAMLR RecName: Full=30S ribosomal protein S20
 gi|222538283|gb|ACM63384.1| 30S ribosomal protein S20 [Campylobacter lari RM2100]
          Length = 87

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +RT  N+  R+ +++  +   EA      E A  A + A   I  
Sbjct: 1  MANHKSAEKRARQTIKRTERNRFYRTRLKNITKAVREAAANNDKEAAANALKIANKSIHA 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
            S+G      ASR+VSRL+
Sbjct: 61 MVSRGFLKKQTASRRVSRLA 80


>gi|119898481|ref|YP_933694.1| 30S ribosomal protein S20 [Azoarcus sp. BH72]
 gi|166200012|sp|A1K7K2|RS20_AZOSB RecName: Full=30S ribosomal protein S20
 gi|119670894|emb|CAL94807.1| 30S ribosomal protein S20 [Azoarcus sp. BH72]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 41/86 (47%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N S RS +R+ ++   +AI  G    A    R + S I  
Sbjct: 1  MANSAQARKRARQATKARAHNASLRSRLRTAIKAVRKAIVGGDKAAAQAVFRTSMSTIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 VADKKIIHKNKAARHKSRLSAAVKAM 86


>gi|1173228|sp|P45788|RS20_AERSO RecName: Full=30S ribosomal protein S20
 gi|1350955|sp|P45786|RS20_AERHY RecName: Full=30S ribosomal protein S20
 gi|665956|gb|AAA86997.1| ribosomal protein S20 homolog [Aeromonas sobria]
          Length = 72

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS  R++++    AI  G    AT A   A+ ++ +  +KG+ H N A+R  SRLS
Sbjct: 13 NASRRSMTRTYLKKVIAAIASGDKAAATAAFAVAQPIMDRMATKGLIHKNKAARHKSRLS 72


>gi|254430726|ref|ZP_05044429.1| ribosomal protein S20 [Cyanobium sp. PCC 7001]
 gi|197625179|gb|EDY37738.1| ribosomal protein S20 [Cyanobium sp. PCC 7001]
          Length = 101

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITF-------GKIEEATEACRK 53
          MAN  S+KK I    R  L N+S RS++R+ M+    A +        G  E   ++   
Sbjct: 1  MANNKSSKKRIEIAERNRLRNRSYRSALRTLMKRCFTACSAYVQAPAEGDKEAVQQSMSA 60

Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A S I KA   G  H N  + + SRLS  +K  +  A
Sbjct: 61 AFSKIDKAVKVGALHRNTGAHQKSRLSAAVKQAIEPA 97


>gi|284035457|ref|YP_003385387.1| ribosomal protein S20 [Spirosoma linguale DSM 74]
 gi|283814750|gb|ADB36588.1| ribosomal protein S20 [Spirosoma linguale DSM 74]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 3/89 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S+KK IR  A++ L+N+ +  + R+ ++   +  T      A E  +   S + K
Sbjct: 1  MANHKSSKKAIRSSAKKRLLNRYQHVTTRNMVK---KLRTTTDHAMAVELYKAVSSALDK 57

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTS 89
             + I H N AS   S+L++ + G+ T+
Sbjct: 58 LAKRNIIHKNKASNNKSKLARLVNGLKTA 86


>gi|307704610|ref|ZP_07641512.1| ribosomal protein S20 [Streptococcus mitis SK597]
 gi|307621812|gb|EFO00847.1| ribosomal protein S20 [Streptococcus mitis SK597]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 7/83 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K      ++   N +++S++R+ ++      TF +   + E  R A S I K
Sbjct: 1  MANIKSAIKRAELNVKQNEKNSAQKSAMRTAIK------TF-EANPSEELFRAASSAIDK 53

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A++KG+ H N ASR  +RLS +L
Sbjct: 54 AETKGLIHKNKASRDKARLSAKL 76


>gi|288905341|ref|YP_003430563.1| Ribosomal protein subunit S20 [Streptococcus gallolyticus UCN34]
 gi|288732067|emb|CBI13632.1| Ribosomal protein subunit S20 [Streptococcus gallolyticus UCN34]
          Length = 81

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRSAIKAFEANPSEEL---FRAASSSIDKAESKGLIHKNKASRDKARLAAKL 79


>gi|312865914|ref|ZP_07726135.1| ribosomal protein S20 [Streptococcus downei F0415]
 gi|311098318|gb|EFQ56541.1| ribosomal protein S20 [Streptococcus downei F0415]
          Length = 77

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K      ++   N +++S++R+       AI   +   + E  R A S I K
Sbjct: 1  MANIKSAIKRAELNVKQNEKNSAQKSALRT-------AIKAFEANPSEELFRAASSAIDK 53

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A+SKG+ H N ASR  +RL+ +L
Sbjct: 54 AQSKGLIHKNKASRDKARLAAKL 76


>gi|237738282|ref|ZP_04568763.1| SSU ribosomal protein S20P [Fusobacterium mortiferum ATCC 9817]
 gi|229420162|gb|EEO35209.1| SSU ribosomal protein S20P [Fusobacterium mortiferum ATCC 9817]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MA+  SAKK +    R    N++ +S V++ ++    A+   ++E A  A   A   + K
Sbjct: 1  MAHSRSAKKRVLIAERNRERNQAVKSRVKTMVKKVLAAVEVKEVEAANAALSVAYKELDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KGI   N ASRK +RL+ ++  +
Sbjct: 61 AVTKGIIKKNTASRKKARLAAKVNAL 86


>gi|54023363|ref|YP_117605.1| 30S ribosomal protein S20 [Nocardia farcinica IFM 10152]
 gi|59798617|sp|Q5Z000|RS20_NOCFA RecName: Full=30S ribosomal protein S20
 gi|54014871|dbj|BAD56241.1| putative ribosomal protein S20 [Nocardia farcinica IFM 10152]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 4/82 (4%)

Query: 1  MANKDSAKKMIR--KIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
          MAN  S  K IR  + AR+   N+S +S++R+ +R   EA   G  ++A E  + A   +
Sbjct: 1  MANIKSQMKRIRTNEAARKR--NQSVKSALRTAIRSFREAAEAGDKDKAAERLQFASRKL 58

Query: 59 QKAKSKGIFHGNAASRKVSRLS 80
           KA SKG+ H N A+ K S L+
Sbjct: 59 DKAASKGVIHPNQAANKKSALA 80


>gi|255088299|ref|XP_002506072.1| predicted protein [Micromonas sp. RCC299]
 gi|226521343|gb|ACO67330.1| predicted protein [Micromonas sp. RCC299]
          Length = 208

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 15/86 (17%)

Query: 19  LINKSRRSSVRSFMRH---------ANEAITFGKIEEATEACRKAESVIQKAKSKGIFHG 69
           L NK R+S + + M+          A EA +  +I +  +   +A   + KA +KG+ H 
Sbjct: 123 LYNKMRKSEITTRMKKVFLKATALGAQEACSEEEIGDLEKLISEATKAVDKAIAKGVLHK 182

Query: 70  NAASRKVSRLSK------RLKGILTS 89
           N  +R+ SR+SK      R KG+LT+
Sbjct: 183 NTGARRKSRMSKYKQDLRRSKGLLTA 208


>gi|225870429|ref|YP_002746376.1| 30S ribosomal protein S20 [Streptococcus equi subsp. equi 4047]
 gi|225699833|emb|CAW93678.1| 30S ribosomal protein S20 [Streptococcus equi subsp. equi 4047]
          Length = 82

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSSIDKAQSKGLIHKNKASRDKARLAAKL 81


>gi|324993043|gb|EGC24963.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK405]
 gi|324995648|gb|EGC27560.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK678]
 gi|325696646|gb|EGD38535.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK160]
 gi|327461311|gb|EGF07642.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK1]
 gi|327473949|gb|EGF19362.1| 30S ribosomal protein S20 [Streptococcus sanguinis SK408]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 11/59 (18%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          R++++SF  + +E           E  R A S I KA++KG+ H N ASR  +RLS +L
Sbjct: 29 RTAIKSFEANPSE-----------ELFRAASSAIDKAETKGLIHKNKASRDKARLSAKL 76


>gi|225849410|ref|YP_002729574.1| ribosomal protein S20 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644165|gb|ACN99215.1| ribosomal protein S20 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 97

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 8/90 (8%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          + +K   KK +R   RR L N+   S +++  +   E +     +E  EA  K   + QK
Sbjct: 11 LKHKRRVKKNVRVAERRRLENRYHISRMKTAFKKFYETLK----KEGKEAAEKLLPLCQK 66

Query: 61 ----AKSKGIFHGNAASRKVSRLSKRLKGI 86
              A +KG  H N A+R+VSR +KRLK +
Sbjct: 67 LAYRAAAKGAIHKNEAARRVSRAAKRLKQV 96


>gi|24216498|ref|NP_713979.1| 30S ribosomal protein S20 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|45656346|ref|YP_000432.1| 30S ribosomal protein S20 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|59798778|sp|Q72V55|RS20_LEPIC RecName: Full=30S ribosomal protein S20
 gi|59798910|sp|Q8EZQ3|RS20_LEPIN RecName: Full=30S ribosomal protein S20
 gi|24197806|gb|AAN50997.1| 30S ribosomal protein S20 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|45599580|gb|AAS69069.1| 30S ribosomal protein S20 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S++K IR+  RR   N   RS +R+  +   +AI     + A     +  S++ K
Sbjct: 1  MANIKSSEKDIRRTKRRNAANSQNRSRLRTQAKKVLKAIKEKDQKAAMTLFIEYTSLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A    + H   A RK SR++KRL
Sbjct: 61 AAKTNLIHSKNADRKKSRMAKRL 83


>gi|319946683|ref|ZP_08020917.1| 30S ribosomal protein S20 [Streptococcus australis ATCC 700641]
 gi|319746731|gb|EFV98990.1| 30S ribosomal protein S20 [Streptococcus australis ATCC 700641]
          Length = 80

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRTAIKAFEANPSEEL---YRAASSAIDKAETKGLIHKNKASRDKARLAAKL 79


>gi|306831421|ref|ZP_07464579.1| 30S ribosomal protein S20 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|306833534|ref|ZP_07466661.1| 30S ribosomal protein S20 [Streptococcus bovis ATCC 700338]
 gi|304424304|gb|EFM27443.1| 30S ribosomal protein S20 [Streptococcus bovis ATCC 700338]
 gi|304426206|gb|EFM29320.1| 30S ribosomal protein S20 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
          Length = 83

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRSAIKAFEANPSEEL---FRAASSSIDKAESKGLIHKNKASRDKARLAAKL 81


>gi|187918105|ref|YP_001883668.1| 30S ribosomal protein S20 [Borrelia hermsii DAH]
 gi|226735302|sp|B2RZU2|RS20_BORHD RecName: Full=30S ribosomal protein S20
 gi|119860953|gb|AAX16748.1| SSU ribosomal protein S20P [Borrelia hermsii DAH]
          Length = 85

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (48%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K  R+  +R L N S +S +++  +     I  GK EEA E  +     +  
Sbjct: 1  MGNNPSALKRARQNLKRNLRNVSVKSELKTIEKRCMSLIREGKKEEALEFFKFVSKKLDT 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  K I H N A+RK S LS
Sbjct: 61 AARKRIIHRNKAARKKSNLS 80


>gi|256372074|ref|YP_003109898.1| ribosomal protein S20 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256008658|gb|ACU54225.1| ribosomal protein S20 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN     K IR+  RR   NK+ RS +++ ++ A +  T    ++  +  R A   + K
Sbjct: 1  MANIKGQLKRIRQDERRRERNKAVRSELKTRVKRALQNATA---DDGEQYLRAAIQRLDK 57

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A  KGI H N A+R+ SRL
Sbjct: 58 AAKKGIIHPNQAARRKSRL 76


>gi|256832780|ref|YP_003161507.1| 30S ribosomal protein S20 [Jonesia denitrificans DSM 20603]
 gi|256686311|gb|ACV09204.1| ribosomal protein S20 [Jonesia denitrificans DSM 20603]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K  R   +  L NK+ +S V++++R   EA+  G  E A  A   A   + K
Sbjct: 1  MANIKSQIKRNRTNEKARLRNKAVKSEVKTYVRAVREAVAAGDKEAAVAALAVASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H N A+ + S L+K +  +
Sbjct: 61 AATKGVIHKNQAANRKSGLAKAVNAL 86


>gi|1173227|sp|P45787|RS20_AERSA RecName: Full=30S ribosomal protein S20
 gi|665958|gb|AAA86998.1| ribosomal protein S20 homolog [Aeromonas salmonicida]
          Length = 72

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          N SRRS  R++++    AI  G    A  A   A+ ++ +  +KG+ H N A+R  SRLS
Sbjct: 13 NASRRSMTRTYLKKVIAAIASGDKAAAVAAFATAQPIMDRMATKGLIHKNKAARHKSRLS 72


>gi|194364900|ref|YP_002027510.1| 30S ribosomal protein S20 [Stenotrophomonas maltophilia R551-3]
 gi|226695428|sp|B4SP15|RS20_STRM5 RecName: Full=30S ribosomal protein S20
 gi|194347704|gb|ACF50827.1| ribosomal protein S20 [Stenotrophomonas maltophilia R551-3]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++   R   N ++RS +R+ ++   +A+       A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAKQTVVRNARNVAQRSMLRTAVKKVIKALDANDAAGAQAAFAVAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+R  SRL+ R+K +
Sbjct: 61 FSARGLIHKNKAARHKSRLNDRIKAL 86


>gi|157165436|ref|YP_001465967.1| 30S ribosomal protein S20 [Campylobacter concisus 13826]
 gi|166223919|sp|A7ZB09|RS20_CAMC1 RecName: Full=30S ribosomal protein S20
 gi|112801708|gb|EAT99052.1| ribosomal protein S20 [Campylobacter concisus 13826]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +RT  N+  R+ +++  +    A+    +  A EA + A   I  
Sbjct: 1  MANHKSAEKRARQTIKRTERNRFYRTRLKNITKAVRVAVEAKDLNAANEALKVANKSIHS 60

Query: 61 AKSKGIFHGNAASRKVSRLSK 81
            S+G      A+R+VSRL++
Sbjct: 61 FVSRGFLKKQTAARRVSRLAQ 81


>gi|81588574|sp|Q8DZZ2|RS20_STRA5 RecName: Full=30S ribosomal protein S20
 gi|22533972|gb|AAM99834.1|AE014235_7 ribosomal protein S20 [Streptococcus agalactiae 2603V/R]
 gi|76561985|gb|ABA44569.1| ribosomal protein S20 [Streptococcus agalactiae A909]
 gi|319744975|gb|EFV97304.1| 30S ribosomal protein S20 [Streptococcus agalactiae ATCC 13813]
          Length = 82

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA SKG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---YRAASSSIDKAASKGLIHTNKASRDKARLATKL 81


>gi|315222901|ref|ZP_07864780.1| ribosomal protein S20 [Streptococcus anginosus F0211]
 gi|319939039|ref|ZP_08013403.1| 30S ribosomal protein S20 [Streptococcus anginosus 1_2_62CV]
 gi|315187851|gb|EFU21587.1| ribosomal protein S20 [Streptococcus anginosus F0211]
 gi|319812089|gb|EFW08355.1| 30S ribosomal protein S20 [Streptococcus anginosus 1_2_62CV]
          Length = 81

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRSAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLASKL 79


>gi|296876350|ref|ZP_06900402.1| 30S ribosomal protein S20 [Streptococcus parasanguinis ATCC
          15912]
 gi|322389701|ref|ZP_08063248.1| 30S ribosomal protein S20 [Streptococcus parasanguinis ATCC 903]
 gi|296432640|gb|EFH18435.1| 30S ribosomal protein S20 [Streptococcus parasanguinis ATCC
          15912]
 gi|321143540|gb|EFX38971.1| 30S ribosomal protein S20 [Streptococcus parasanguinis ATCC 903]
          Length = 82

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---YRAASSAIDKAETKGLIHKNKASRDKARLAAKL 81


>gi|292558416|gb|ADE31417.1| ribosomal protein S20 [Streptococcus suis GZ1]
          Length = 80

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLASKL 79


>gi|91785021|ref|YP_560227.1| 30S ribosomal protein S20 [Burkholderia xenovorans LB400]
 gi|296157210|ref|ZP_06840046.1| ribosomal protein S20 [Burkholderia sp. Ch1-1]
 gi|118573809|sp|Q13UR4|RS20_BURXL RecName: Full=30S ribosomal protein S20
 gi|91688975|gb|ABE32175.1| SSU ribosomal protein S20P [Burkholderia xenovorans LB400]
 gi|295892546|gb|EFG72328.1| ribosomal protein S20 [Burkholderia sp. Ch1-1]
          Length = 92

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+ A+    N + RS  R+ ++   +AI  G   +A E    +   I  
Sbjct: 1  MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDKAKAAEIFLASSKTIDI 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
             K I H N A+R  SRL+  +KG+   A
Sbjct: 61 IADKKIVHKNKAARHKSRLAAAIKGLQAPA 90


>gi|254491035|ref|ZP_05104216.1| ribosomal protein S20 [Methylophaga thiooxidans DMS010]
 gi|224463548|gb|EEF79816.1| ribosomal protein S20 [Methylophaga thiooxydans DMS010]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+     L N S+RS++R+ ++    AI  G  E+A  A + A   + +
Sbjct: 1  MANSAQARKRARQAEVHRLRNASQRSAMRTSIKALRRAIAAGDKEQAVAAFQAAVPALDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             KGI H N A+R  SRL+  ++ +
Sbjct: 61 MARKGIIHKNTAARGKSRLNNAVRAM 86


>gi|76798870|ref|ZP_00781078.1| ribosomal protein S20 [Streptococcus agalactiae 18RS21]
 gi|77406480|ref|ZP_00783535.1| ribosomal protein S20 [Streptococcus agalactiae H36B]
 gi|77409395|ref|ZP_00786094.1| ribosomal protein S20 [Streptococcus agalactiae COH1]
 gi|77411037|ref|ZP_00787392.1| ribosomal protein S20 [Streptococcus agalactiae CJB111]
 gi|77413261|ref|ZP_00789458.1| ribosomal protein S20 [Streptococcus agalactiae 515]
 gi|76585766|gb|EAO62316.1| ribosomal protein S20 [Streptococcus agalactiae 18RS21]
 gi|77160721|gb|EAO71835.1| ribosomal protein S20 [Streptococcus agalactiae 515]
 gi|77162961|gb|EAO73917.1| ribosomal protein S20 [Streptococcus agalactiae CJB111]
 gi|77172004|gb|EAO75174.1| ribosomal protein S20 [Streptococcus agalactiae COH1]
 gi|77174915|gb|EAO77729.1| ribosomal protein S20 [Streptococcus agalactiae H36B]
          Length = 80

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA SKG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRTAIKAFEANPSEEL---YRAASSSIDKAASKGLIHTNKASRDKARLATKL 79


>gi|325978328|ref|YP_004288044.1| 30S ribosomal protein S20 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
 gi|325178256|emb|CBZ48300.1| 30S ribosomal protein S20 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 20 KNSAQKSAMRSAIKAFEANPSEEL---FRAASSSIDKAESKGLIHKNKASRDKARLAAKL 76


>gi|319651623|ref|ZP_08005750.1| 30S ribosomal protein S20 [Bacillus sp. 2_A_57_CT2]
 gi|317396690|gb|EFV77401.1| 30S ribosomal protein S20 [Bacillus sp. 2_A_57_CT2]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    R   N + +S++R+ ++  + A+       ATE+   A   + K
Sbjct: 1  MPNIKSAIKRVKTSEARNAHNATVKSAMRTAVKKVDAAVVNNDAAAATESFADAARKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A +KG+ H NAA+RK SRL K++  +
Sbjct: 61 AAAKGLIHKNAAARKKSRLMKKMNSL 86


>gi|317153437|ref|YP_004121485.1| 30S ribosomal protein S20 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943688|gb|ADU62739.1| ribosomal protein S20 [Desulfovibrio aespoeensis Aspo-2]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +R   N+  ++ +++ ++    AI    + +A EA + A S++ K
Sbjct: 1  MANHKSALKRHRQSLKRRARNRISKTRIKNTVKAVRMAIEENDVTKAQEALKSATSLLDK 60

Query: 61 AKSKGIFHGNAASRKVSRL 79
          A    + H   A R+V+RL
Sbjct: 61 AARTNVIHARQAQRRVARL 79


>gi|282891135|ref|ZP_06299639.1| hypothetical protein pah_c047o030 [Parachlamydia acanthamoebae
          str. Hall's coccus]
 gi|281498952|gb|EFB41267.1| hypothetical protein pah_c047o030 [Parachlamydia acanthamoebae
          str. Hall's coccus]
          Length = 96

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 16 RRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRK 75
          +R L NK+ +SSVR+ +R   E +        TE   +  S++ K   KG++  N ASR 
Sbjct: 25 KRRLRNKAFKSSVRTAIRQFEETVAKKDPALITERLNEVYSLMDKGVKKGVYKLNKASRT 84

Query: 76 VSRLS 80
           SRL+
Sbjct: 85 KSRLA 89


>gi|302845395|ref|XP_002954236.1| plastid/chloroplast ribosomal protein S20 [Volvox carteri f.
           nagariensis]
 gi|300260441|gb|EFJ44660.1| plastid/chloroplast ribosomal protein S20 [Volvox carteri f.
           nagariensis]
          Length = 190

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 16/102 (15%)

Query: 2   ANKDSAKKMIRKIAR------RTLINKSRRSS----VRSFMRHANEAITFGKI--EEATE 49
           A KD  KKM   + R      R L NKSR+S+    V+  ++ A   ++      E+  +
Sbjct: 47  AKKDQKKKMPSPVKRALLAEERRLYNKSRKSACATRVKKVIKMAESLMSTADAHSEDQVK 106

Query: 50  ACRK----AESVIQKAKSKGIFHGNAASRKVSRLSKRLKGIL 87
           A  K    A + I KA  KGI H N A+RK +R ++  K +L
Sbjct: 107 ALEKLVSEAYTEIDKAVVKGILHENTAARKKARCARYKKHVL 148


>gi|190573349|ref|YP_001971194.1| 30S ribosomal protein S20 [Stenotrophomonas maltophilia K279a]
 gi|254523280|ref|ZP_05135335.1| ribosomal protein S20 [Stenotrophomonas sp. SKA14]
 gi|226695429|sp|B2FTI7|RS20_STRMK RecName: Full=30S ribosomal protein S20
 gi|190011271|emb|CAQ44884.1| putative 30S ribosomal protein S20 [Stenotrophomonas maltophilia
          K279a]
 gi|219720871|gb|EED39396.1| ribosomal protein S20 [Stenotrophomonas sp. SKA14]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++   R   N ++RS +R+ ++   +A+       A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAKQTVVRNARNVAQRSMLRTAVKKVIKALDANDAAGAEAAFAVAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+R  SRL+ R+K +
Sbjct: 61 FSARGLIHKNKAARHKSRLNDRIKAL 86


>gi|220936367|ref|YP_002515266.1| ribosomal protein S20 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254813072|sp|B8GQQ5|RS20_THISH RecName: Full=30S ribosomal protein S20
 gi|219997677|gb|ACL74279.1| ribosomal protein S20 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA+K  R+  +    N + RS  R+ ++   +A+  G  E A  A + A  VI  
Sbjct: 1  MANIASARKRARQAEKNRQHNMALRSRFRTSVKKVLKAVVAGDKEAAQAALKAAVPVIDG 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            +KG+ H N A+R  SRL+ R+K +
Sbjct: 61 TVNKGLIHKNKAARHKSRLNARVKAM 86


>gi|25010992|ref|NP_735387.1| 30S ribosomal protein S20 [Streptococcus agalactiae NEM316]
 gi|161485614|ref|NP_687962.2| 30S ribosomal protein S20 [Streptococcus agalactiae 2603V/R]
 gi|161486747|ref|YP_329666.2| 30S ribosomal protein S20 [Streptococcus agalactiae A909]
 gi|59798904|sp|Q8E5P3|RS20_STRA3 RecName: Full=30S ribosomal protein S20
 gi|109927167|sp|Q3K1D7|RS20_STRA1 RecName: Full=30S ribosomal protein S20
 gi|23095392|emb|CAD46597.1| 30S ribosomal protein S20 [Streptococcus agalactiae NEM316]
          Length = 77

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA SKG+ H N ASR  +RL+ +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---YRAASSSIDKAASKGLIHTNKASRDKARLATKL 76


>gi|330837190|ref|YP_004411831.1| 30S ribosomal protein S20 [Spirochaeta coccoides DSM 17374]
 gi|329749093|gb|AEC02449.1| 30S ribosomal protein S20 [Spirochaeta coccoides DSM 17374]
          Length = 91

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K  R+  +R + N++ +S++R+ ++    AI  G    A    +++  +I  A +KG
Sbjct: 5  SAEKRERQNEKRRMRNRAAKSAIRTSVKKFKAAIEAGDKATAETTMQRSFKLIDTAANKG 64

Query: 66 IFHGNAASRKVSRL 79
          I H N ASR  SRL
Sbjct: 65 ILHRNTASRTKSRL 78


>gi|306827288|ref|ZP_07460575.1| 30S ribosomal protein S20 [Streptococcus pyogenes ATCC 10782]
 gi|21904606|gb|AAM79479.1| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS315]
 gi|304430435|gb|EFM33457.1| 30S ribosomal protein S20 [Streptococcus pyogenes ATCC 10782]
          Length = 80

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 23 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSSIDKAESKGLIHKNKASRDKARLAAKL 79


>gi|223932351|ref|ZP_03624354.1| ribosomal protein S20 [Streptococcus suis 89/1591]
 gi|253751844|ref|YP_003024985.1| 30S ribosomal protein S20 [Streptococcus suis SC84]
 gi|253753667|ref|YP_003026808.1| 30S ribosomal protein S20 [Streptococcus suis P1/7]
 gi|253755452|ref|YP_003028592.1| 30S ribosomal protein S20 [Streptococcus suis BM407]
 gi|302023867|ref|ZP_07249078.1| 30S ribosomal protein S20 [Streptococcus suis 05HAS68]
 gi|330832909|ref|YP_004401734.1| 30S ribosomal protein S20 [Streptococcus suis ST3]
 gi|223899032|gb|EEF65390.1| ribosomal protein S20 [Streptococcus suis 89/1591]
 gi|251816133|emb|CAZ51757.1| 30S ribosomal protein S20 [Streptococcus suis SC84]
 gi|251817916|emb|CAZ55693.1| 30S ribosomal protein S20 [Streptococcus suis BM407]
 gi|251819913|emb|CAR45984.1| 30S ribosomal protein S20 [Streptococcus suis P1/7]
 gi|329307132|gb|AEB81548.1| 30S ribosomal protein S20 [Streptococcus suis ST3]
          Length = 77

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLASKL 76


>gi|21242005|ref|NP_641587.1| 30S ribosomal protein S20 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|58581246|ref|YP_200262.1| 30S ribosomal protein S20 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|78046843|ref|YP_363018.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84623166|ref|YP_450538.1| 30S ribosomal protein S20 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|166713095|ref|ZP_02244302.1| 30S ribosomal protein S20 [Xanthomonas oryzae pv. oryzicola
          BLS256]
 gi|188575769|ref|YP_001912698.1| 30S ribosomal protein S20 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|289662722|ref|ZP_06484303.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. vasculorum
          NCPPB702]
 gi|289670401|ref|ZP_06491476.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. musacearum
          NCPPB4381]
 gi|325914858|ref|ZP_08177193.1| SSU ribosomal protein S20P [Xanthomonas vesicatoria ATCC 35937]
 gi|325928647|ref|ZP_08189826.1| SSU ribosomal protein S20P [Xanthomonas perforans 91-118]
 gi|23822137|sp|Q8PN22|RS20_XANAC RecName: Full=30S ribosomal protein S20
 gi|62510971|sp|Q5H2E4|RS20_XANOR RecName: Full=30S ribosomal protein S20
 gi|90111927|sp|Q3BW45|RS20_XANC5 RecName: Full=30S ribosomal protein S20
 gi|118574795|sp|Q2P5B3|RS20_XANOM RecName: Full=30S ribosomal protein S20
 gi|226695442|sp|B2STC1|RS20_XANOP RecName: Full=30S ribosomal protein S20
 gi|21107402|gb|AAM36123.1| 30S ribosomal protein S20 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|58425840|gb|AAW74877.1| 30S ribosomal protein S20 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|78035273|emb|CAJ22918.1| 30S ribosomal protein S20 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84367106|dbj|BAE68264.1| 30S ribosomal protein S20 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|188520221|gb|ACD58166.1| ribosomal protein S20 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|325538949|gb|EGD10610.1| SSU ribosomal protein S20P [Xanthomonas vesicatoria ATCC 35937]
 gi|325540975|gb|EGD12538.1| SSU ribosomal protein S20P [Xanthomonas perforans 91-118]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK  ++   R   N  +RS +R+ ++   +A+       A  A   A+ ++ +
Sbjct: 1  MANIKSAKKRAKQTIVRNERNTGQRSMLRTAVKKVIKALDANDAAGAEAAFAVAQPILDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
            ++G+ H N A+R  SRL+ R+K I
Sbjct: 61 FSARGLIHKNKAARHKSRLTARIKAI 86


>gi|56807502|ref|ZP_00365438.1| COG0268: Ribosomal protein S20 [Streptococcus pyogenes M49 591]
 gi|251782464|ref|YP_002996766.1| 30S ribosomal protein S20 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|118573846|sp|Q1JBK1|RS20_STRPB RecName: Full=30S ribosomal protein S20
 gi|118573847|sp|Q1JLI3|RS20_STRPC RecName: Full=30S ribosomal protein S20
 gi|118573848|sp|Q1JGL9|RS20_STRPD RecName: Full=30S ribosomal protein S20
 gi|118573849|sp|Q1J6D8|RS20_STRPF RecName: Full=30S ribosomal protein S20
 gi|118574563|sp|Q48TC9|RS20_STRPM RecName: Full=30S ribosomal protein S20
 gi|28811234|dbj|BAC64167.1| 30S ribosomal protein S20 [Streptococcus pyogenes SSI-1]
 gi|50903355|gb|AAT87070.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS10394]
 gi|71802678|gb|AAX72031.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS6180]
 gi|94542187|gb|ABF32236.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS9429]
 gi|94544077|gb|ABF34125.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS10270]
 gi|94546010|gb|ABF36057.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS2096]
 gi|94547999|gb|ABF38045.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS10750]
 gi|242391093|dbj|BAH81552.1| 30S ribosomal protein S20 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
          Length = 82

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSSIDKAESKGLIHKNKASRDKARLAAKL 81


>gi|322392146|ref|ZP_08065608.1| 30S ribosomal protein S20 [Streptococcus peroris ATCC 700780]
 gi|321145046|gb|EFX40445.1| 30S ribosomal protein S20 [Streptococcus peroris ATCC 700780]
          Length = 82

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRSAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLATKL 81


>gi|146318743|ref|YP_001198455.1| 30S ribosomal protein S20 [Streptococcus suis 05ZYH33]
 gi|146320947|ref|YP_001200658.1| 30S ribosomal protein S20 [Streptococcus suis 98HAH33]
 gi|167011216|sp|A4W1L9|RS20_STRS2 RecName: Full=30S ribosomal protein S20
 gi|167011217|sp|A4VVB6|RS20_STRSY RecName: Full=30S ribosomal protein S20
 gi|145689549|gb|ABP90055.1| Ribosomal protein S20 [Streptococcus suis 05ZYH33]
 gi|145691753|gb|ABP92258.1| Ribosomal protein S20 [Streptococcus suis 98HAH33]
          Length = 82

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 25 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSAIDKAETKGLIHKNKASRDKARLASKL 81


>gi|256828797|ref|YP_003157525.1| 30S riboosomal protein S20 [Desulfomicrobium baculatum DSM 4028]
 gi|256577973|gb|ACU89109.1| ribosomal protein S20 [Desulfomicrobium baculatum DSM 4028]
          Length = 86

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SA K  R+  +    N+  ++ V++  +  + AI     E    A +   S++ K
Sbjct: 1  MANHKSALKRHRQSLKARERNRMMKTRVKNATKALHAAIASNDNEAVANALKNVTSILDK 60

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A SK I H   A+RK+SRLS
Sbjct: 61 AASKKIVHWRTAARKISRLS 80


>gi|457116|gb|AAA24604.1| S20 protein [Escherichia coli]
          Length = 87

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  SAKK   +  +    N SRRS +R+F++     I  G    A +A  + + ++ +
Sbjct: 1  MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYARIEAGDKAAAQKAFNEMQPIVDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
            +KG+ H N A+R  + L+ ++
Sbjct: 61 QAAKGLIHKNKAARHKANLTAQI 83


>gi|237653343|ref|YP_002889657.1| 30S ribosomal protein S20 [Thauera sp. MZ1T]
 gi|237624590|gb|ACR01280.1| ribosomal protein S20 [Thauera sp. MZ1T]
          Length = 88

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 41/86 (47%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  +    N S RS +R+ ++   +AI  G    A    R + S I  
Sbjct: 1  MANSAQARKRARQATKARAHNASLRSRLRTAIKAVRKAIVGGDKAAAQSVFRTSMSTIDS 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N A+R  SRLS  +K +
Sbjct: 61 IADKKIIHKNKAARHKSRLSAAVKAM 86


>gi|148272732|ref|YP_001222293.1| 30S ribosomal protein S20 [Clavibacter michiganensis subsp.
          michiganensis NCPPB 382]
 gi|166223926|sp|A5CR93|RS20_CLAM3 RecName: Full=30S ribosomal protein S20
 gi|147830662|emb|CAN01598.1| 30S ribosomal protein S20 [Clavibacter michiganensis subsp.
          michiganensis NCPPB 382]
          Length = 87

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 21 NKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLS 80
          NK+ +S +++ +R    AIT G  + A +A   A   + KA SKG+ H N A+ +   ++
Sbjct: 21 NKAVKSELKTAIRSVKTAITAGDKDAAVKAVSLAGKKLDKAASKGVIHKNQAANRKGAIA 80

Query: 81 KRL 83
          K++
Sbjct: 81 KQV 83


>gi|229543797|ref|ZP_04432856.1| ribosomal protein S20 [Bacillus coagulans 36D1]
 gi|229324936|gb|EEN90612.1| ribosomal protein S20 [Bacillus coagulans 36D1]
          Length = 86

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 12 RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNA 71
          +  A+ T    + R++V+ F     EA      E A      A   + KA SKG+ H NA
Sbjct: 16 KNYAQNTAAKSAMRTAVKKF-----EAAVENNDENAKALLVDAVKRLDKAASKGLIHKNA 70

Query: 72 ASRKVSRLSKRL 83
          ASR+ SRL K+L
Sbjct: 71 ASRQKSRLMKKL 82


>gi|329117383|ref|ZP_08246100.1| ribosomal protein S20 [Streptococcus parauberis NCFD 2020]
 gi|326907788|gb|EGE54702.1| ribosomal protein S20 [Streptococcus parauberis NCFD 2020]
          Length = 77

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR    AI   +     E  R A S I KA SKG+ H N ASR  +RL+ +L
Sbjct: 20 KNSAQKSAMR---TAIKVYEANPTEELYRAATSSIDKAASKGLIHTNKASRDKARLAAKL 76


>gi|15675196|ref|NP_269370.1| 30S ribosomal protein S20 [Streptococcus pyogenes M1 GAS]
 gi|19746165|ref|NP_607301.1| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS8232]
 gi|71910759|ref|YP_282309.1| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS5005]
 gi|139473695|ref|YP_001128411.1| 30S ribosomal protein S20 [Streptococcus pyogenes str. Manfredo]
 gi|161485743|ref|NP_664676.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS315]
 gi|161486349|ref|NP_802334.2| 30S ribosomal protein S20 [Streptococcus pyogenes SSI-1]
 gi|161761310|ref|YP_060253.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS10394]
 gi|162139081|ref|YP_596780.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS9429]
 gi|162139104|ref|YP_598669.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS10270]
 gi|162139130|ref|YP_600601.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS2096]
 gi|162139181|ref|YP_602589.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS10750]
 gi|162139400|ref|YP_280386.2| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS6180]
 gi|209559501|ref|YP_002285973.1| 30S ribosomal protein S20 [Streptococcus pyogenes NZ131]
 gi|54039473|sp|P66510|RS20_STRP3 RecName: Full=30S ribosomal protein S20
 gi|54039474|sp|P66511|RS20_STRP8 RecName: Full=30S ribosomal protein S20
 gi|54042165|sp|P66509|RS20_STRP1 RecName: Full=30S ribosomal protein S20
 gi|73917927|sp|Q5XBZ3|RS20_STRP6 RecName: Full=30S ribosomal protein S20
 gi|166223992|sp|A2REA5|RS20_STRPG RecName: Full=30S ribosomal protein S20
 gi|226695432|sp|B5XLR6|RS20_STRPZ RecName: Full=30S ribosomal protein S20
 gi|13622362|gb|AAK34091.1| 30S ribosomal protein S20 [Streptococcus pyogenes M1 GAS]
 gi|19748344|gb|AAL97800.1| 30S ribosomal protein S20 [Streptococcus pyogenes MGAS8232]
 gi|71853541|gb|AAZ51564.1| SSU ribosomal protein S20P [Streptococcus pyogenes MGAS5005]
 gi|134271942|emb|CAM30180.1| 30S ribosomal protein S20 [Streptococcus pyogenes str. Manfredo]
 gi|209540702|gb|ACI61278.1| SSU ribosomal protein S20p [Streptococcus pyogenes NZ131]
 gi|322411858|gb|EFY02766.1| 30S ribosomal protein S20 [Streptococcus dysgalactiae subsp.
          dysgalactiae ATCC 27957]
 gi|323127352|gb|ADX24649.1| 30S ribosomal protein S20 [Streptococcus dysgalactiae subsp.
          equisimilis ATCC 12394]
          Length = 77

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          + S+ +S MR A +A      EE     R A S I KA+SKG+ H N ASR  +RL+ +L
Sbjct: 20 KNSAQKSAMRTAIKAFEANPSEEL---FRAASSSIDKAESKGLIHKNKASRDKARLAAKL 76


>gi|119963912|ref|YP_947982.1| 30S ribosomal protein S20 [Arthrobacter aurescens TC1]
 gi|166200010|sp|A1R6X0|RS20_ARTAT RecName: Full=30S ribosomal protein S20
 gi|119950771|gb|ABM09682.1| ribosomal protein S20 [Arthrobacter aurescens TC1]
          Length = 86

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S KK I    +  L N + +S +++ +R  N A+     + A  A   A   + K
Sbjct: 1  MANIKSQKKRILTNEKARLRNNAVKSELKTAIRAVNTAVESADKDAAGTALVAASRKLDK 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
          A SKG+ H N A+ + S +SK++  +
Sbjct: 61 AVSKGVIHKNNAANRKSAISKKVNAL 86


>gi|312866667|ref|ZP_07726881.1| ribosomal protein S20 [Streptococcus parasanguinis F0405]
 gi|311097748|gb|EFQ55978.1| ribosomal protein S20 [Streptococcus parasanguinis F0405]
          Length = 77

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 11/59 (18%)

Query: 25 RSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVSRLSKRL 83
          R++++SF  + +E           E  R A S I KA++KG+ H N ASR  +RL+ +L
Sbjct: 29 RTAIKSFEANPSE-----------ELYRAASSAIDKAETKGLIHKNKASRDKARLAAKL 76


>gi|253995902|ref|YP_003047966.1| 30S ribosomal protein S20 [Methylotenera mobilis JLW8]
 gi|253982581|gb|ACT47439.1| ribosomal protein S20 [Methylotenera mobilis JLW8]
          Length = 87

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A+K  R+  ++   N S RS++R+ ++   +A+  G    AT A  +  SVI +
Sbjct: 1  MANTAQARKRARQAVKQRAHNASLRSTLRTAIKKIIKAVEAGDKAAATAAYSENVSVIDR 60

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGI 86
             K I H N ASR  SRL+  +K +
Sbjct: 61 IADKNIIHKNKASRHKSRLNAAIKAM 86


>gi|303239325|ref|ZP_07325853.1| ribosomal protein S20 [Acetivibrio cellulolyticus CD2]
 gi|302593111|gb|EFL62831.1| ribosomal protein S20 [Acetivibrio cellulolyticus CD2]
          Length = 88

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          M N  SA K ++    +TL N  ++S +++ ++   EAI       AT   +     I K
Sbjct: 1  MPNIKSAIKRVKVTKAKTLKNSIKKSVLKTTIKKCKEAIATNDASAAT-VLKSTIETIDK 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          + +K I H N A+R+ S+L+K L
Sbjct: 60 SAAKNILHKNTAARRKSKLAKAL 82


>gi|255640470|gb|ACU20521.1| unknown [Glycine max]
          Length = 164

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 5   DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEA---------CRKAE 55
           DSA K  R+  +R + NK+R+S +++  +   EA+   K ++  +A           +A 
Sbjct: 59  DSAVKRARQAEKRRVYNKARKSEIKTRTKKVLEALEVLKKKQDAQAEEILSIEKLIGEAY 118

Query: 56  SVIQKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           S+I KA   G  H N  + + SRL++R K +
Sbjct: 119 SIIDKAVRVGTLHRNTGANRKSRLARRKKAV 149


>gi|33236623|gb|AAP98711.1| ribosomal protein S20 [Chlamydophila pneumoniae TW-183]
          Length = 104

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA+K I    +R LIN S +S V++ ++    ++     +      +   SV+ KA  +G
Sbjct: 22 SAEKRILTAQKRELINHSFKSKVKTIVKKFEASLKLDDTQATLSNLQSVYSVVDKAVKRG 81

Query: 66 IFHGNAASR 74
          IF  N A+R
Sbjct: 82 IFKDNKAAR 90


>gi|315924404|ref|ZP_07920626.1| 30S ribosomal protein S20 [Pseudoramibacter alactolyticus ATCC
          23263]
 gi|315622283|gb|EFV02242.1| 30S ribosomal protein S20 [Pseudoramibacter alactolyticus ATCC
          23263]
          Length = 88

 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 4/88 (4%)

Query: 1  MANKDSAKKMIR--KIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVI 58
          MAN  SA K  +  +IAR  + NK+ R+++++  +     I+ G    A +A   A   +
Sbjct: 1  MANIKSAMKRAKTNEIAR--MRNKAVRTNLKTVEKQFKAVISEGDAARAQDAFNTAAKRL 58

Query: 59 QKAKSKGIFHGNAASRKVSRLSKRLKGI 86
           +A +K + H NAASRK S+L+K L  +
Sbjct: 59 DQAVAKHVIHKNAASRKKSQLAKALNKV 86


>gi|313678709|ref|YP_004056449.1| 30S ribosomal protein S20 [Mycoplasma bovis PG45]
 gi|312950803|gb|ADR25398.1| ribosomal protein S20 [Mycoplasma bovis PG45]
          Length = 89

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I K       N + ++ VR  +R A EA+   K E   +   +A S+I  
Sbjct: 1  MANIKSKVKSIAKQEEFRQRNNAMKTRVRKAIRAAREAV-LAKEEGFEKKVFEAHSIIAT 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  KGI+H N  +RK SRL 
Sbjct: 60 AVQKGIYHPNKGARKSSRLD 79


>gi|313885180|ref|ZP_07818932.1| ribosomal protein S20 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619871|gb|EFR31308.1| ribosomal protein S20 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 84

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN   A K +R+   +  +NK++ S +R+ +++   A+     + A E    A S I +
Sbjct: 1  MANSAQATKRVRQNTTKRDLNKAQVSEMRTAIKNFKAAVE-SSADNAQELFNAAASKIDR 59

Query: 61 AKSKGIFHGNAASRKVSRLSKRL 83
          A   G+ HGN A R  ++L+  L
Sbjct: 60 AAKNGLIHGNKADRDKAKLNSLL 82


>gi|291320123|ref|YP_003515381.1| 30S ribosomal protein S20 [Mycoplasma agalactiae]
 gi|290752452|emb|CBH40424.1| 30S ribosomal protein S20 [Mycoplasma agalactiae]
          Length = 89

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
          MAN  S  K I K       N + ++ VR  +R A EA+   K E   +   +A S+I  
Sbjct: 1  MANIKSKVKSIAKQEEFRQRNNAMKTRVRKAIRAAREAV-LAKEEGFEKKVSEAHSIIAT 59

Query: 61 AKSKGIFHGNAASRKVSRLS 80
          A  KG++H N  +RK SRL 
Sbjct: 60 AVQKGVYHPNKGARKSSRLD 79


>gi|188026530|ref|ZP_02962466.2| hypothetical pr