PSIBLAST alignment of GI: 254780626 and protein with PDB id: 1ibk

gi|14278075|pdb|1IBK|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin Length = 106
>gi|14278096|pdb|1IBL|T Chain T, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin Length = 106
 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 11 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGS 70

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 71 TLHKNAAARRKSRLMRKVRQLLEAA 95