PSIBLAST alignment of GI: 254780626 and protein with PDB id: 1p6g

>gi|33357897|pdb|1P6G|T Chain T, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 86
>gi|33357974|pdb|1P87|T Chain T, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome Length = 86
 Score = 72.7 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 45/86 (52%)

Query: 2  ANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKA 61
          AN  SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ + 
Sbjct: 1  ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQ 60

Query: 62 KSKGIFHGNAASRKVSRLSKRLKGIL 87
           +KG+ H N A+R  + L+ ++  + 
Sbjct: 61 AAKGLIHKNKAARHKANLTAQINKLA 86