PSIBLAST alignment of GI: 254780626 and protein with PDB id: 2e5l

>gi|149241294|pdb|2E5L|T Chain T, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction Length = 105
>gi|226887648|pdb|2ZM6|T Chain T, Crystal Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Length = 105
 Score = 63.8 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 10 SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGS 69

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 70 TLHKNAAARRKSRLMRKVRQLLEAA 94