PSIBLAST alignment of GI: 254780626 and protein with PDB id: 2gy9

>gi|116667429|pdb|2GY9|T Chain T, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 83
>gi|116667481|pdb|2GYB|T Chain T, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 Length = 83
 Score = 68.8 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 43/83 (51%)

Query: 5  DSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSK 64
           SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +  +K
Sbjct: 1  KSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAK 60

Query: 65 GIFHGNAASRKVSRLSKRLKGIL 87
          G+ H N A+R  + L+ ++  + 
Sbjct: 61 GLIHKNKAARHKANLTAQINKLA 83