RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str. psy62] (90 letters) >gnl|CDD|30617 COG0268, RpsT, Ribosomal protein S20 [Translation, ribosomal structure and biogenesis]. Length = 88 Score = 56.8 bits (137), Expect = 1e-09 Identities = 38/88 (43%), Positives = 54/88 (61%) Query: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60 MAN SAKK R+ +R L NKSR+S++R+ ++ AI G E A A ++A+ I K Sbjct: 1 MANIKSAKKRARQSEKRRLRNKSRKSALRTAIKKVEAAIEAGDKEAAKAALKEAQKKIDK 60 Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILT 88 A SKG+ H N A+RK SRL+ +L + Sbjct: 61 AASKGVIHKNKAARKKSRLAAKLNKLAA 88 >gnl|CDD|145013 pfam01649, Ribosomal_S20p, Ribosomal protein S20. Bacterial ribosomal protein S20 interacts with 16S rRNA. Length = 84 Score = 53.9 bits (130), Expect = 1e-08 Identities = 37/83 (44%), Positives = 53/83 (63%) Query: 2 ANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKA 61 AN SAKK IR+ +R L NKS +S +R+ ++ EAI G+ ++A EA ++ +S I KA Sbjct: 1 ANIKSAKKRIRQNEKRRLRNKSYKSKMRTLIKKVREAIEAGEKDKAKEALKEVQSKIDKA 60 Query: 62 KSKGIFHGNAASRKVSRLSKRLK 84 KG+ H N A+RK SRL+ L Sbjct: 61 AKKGVIHKNTAARKKSRLAAILN 83 >gnl|CDD|177031 CHL00102, rps20, ribosomal protein S20. Length = 93 Score = 44.0 bits (104), Expect = 1e-05 Identities = 33/91 (36%), Positives = 48/91 (52%), Gaps = 7/91 (7%) Query: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKI-------EEATEACRK 53 MAN SA K I+ R L NK+ +SSV++ ++ + + K ++ E Sbjct: 1 MANNKSAIKRIKISERNRLRNKAYKSSVKTLIKKYLKNLEDYKTSPNSNNKKKVQETLSS 60 Query: 54 AESVIQKAKSKGIFHGNAASRKVSRLSKRLK 84 S I KA KG+FH N A+RK S+L+K LK Sbjct: 61 VYSKIDKAVKKGVFHKNTAARKKSKLAKALK 91 >gnl|CDD|37043 KOG1832, KOG1832, KOG1832, HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]. Length = 1516 Score = 27.4 bits (60), Expect = 0.94 Identities = 16/83 (19%), Positives = 34/83 (40%), Gaps = 12/83 (14%) Query: 11 IRKIARRTLINKSRRSSVRSFMRH------------ANEAITFGKIEEATEACRKAESVI 58 IR +A R L+ +R +VR + E +T+ K E + C+ A +++ Sbjct: 760 IRALACRVLLGLARDDTVRQILTKLPLVTNERAQILMAEPVTYDKRHEHLQFCKLASALL 819 Query: 59 QKAKSKGIFHGNAASRKVSRLSK 81 ++A+ + S ++ Sbjct: 820 KEAQGTPLPSSAGPSSIAYSTTQ 842 >gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription]. Length = 895 Score = 25.3 bits (55), Expect = 3.5 Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Query: 3 NKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKA 54 + + K+ R + L +R + AN G +EEA E + Sbjct: 119 STGTKKRGRRSRGKSKL-----APELRQLLGEANNLFARGDLEEAEEILMEV 165 >gnl|CDD|146650 pfam04121, Nup84_Nup100, Nuclear pore protein 84 / 107. Nup84p forms a complex with five proteins, of which Nup120p, Nup85p, Sec13p, and a Sec13p homologues. This Nup84p complex in conjunction with Sec13-type proteins is required for correct nuclear pore biogenesis. Length = 685 Score = 24.2 bits (53), Expect = 8.2 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 31 FMRHANEAITFGKIEEATEACRK 53 ++ E I G+I+EA E C Sbjct: 132 LFKYIFELIRAGRIDEALELCEL 154 >gnl|CDD|146587 pfam04029, 2-ph_phosp, 2-phosphosulpholactate phosphatase. Thought to catalyse 2-phosphosulpholactate = sulpholactate + phosphate. Probable magnesium cofactor. Involved in the second step of coenzyme M biosynthesis. Inhibited by vanadate in Methanococcus jannaschii. Also known as the ComB family. Length = 231 Score = 24.1 bits (53), Expect = 8.5 Identities = 8/28 (28%), Positives = 10/28 (35%) Query: 31 FMRHANEAITFGKIEEATEACRKAESVI 58 A I IEEA +K E + Sbjct: 34 LANGARAIIPVADIEEALALKKKIEGYL 61 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.124 0.319 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 846,565 Number of extensions: 33179 Number of successful extensions: 145 Number of sequences better than 10.0: 1 Number of HSP's gapped: 144 Number of HSP's successfully gapped: 25 Length of query: 90 Length of database: 6,263,737 Length adjustment: 59 Effective length of query: 31 Effective length of database: 4,988,806 Effective search space: 154652986 Effective search space used: 154652986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)