RPSBLAST alignment of GI: 254780626 and protein with PDBid: 2vqe

>2vqe_T 30S ribosomal protein S20; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.7.6.1 PDB: 1gix_W* 1hnw_T* 1hnx_T* 1hnz_T* 1hr0_T 1j5e_T 1jgo_W* 1jgp_W* 1jgq_W* 1ml5_W* 1yl4_W 2b64_T* 2b9m_T* 2b9o_T* 2f4v_T* 2ow8_u* 2qnh_u* 2uxb_T* 1fjg_T* 2uxd_T* ... Length = 106
 Score = 73.2 bits (180), Expect = 1e-14
 Identities = 33/90 (36%), Positives = 54/90 (60%)

Query: 1  MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60
               SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I K
Sbjct: 6  PKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDK 65

Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
          A      H NAA+R+ SRL ++++ +L +A
Sbjct: 66 AAKGSTLHKNAAARRKSRLMRKVRQLLEAA 95