RPSBLAST alignment of GI: 254780626 and protein with PDBid: 3bbn

>3bbn_T Ribosomal protein S20; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Length = 202
 Score = 71.6 bits (175), Expect = 4e-14
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 9/99 (9%)

Query: 1   MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGK---------IEEATEAC 51
               DSA K  R+  +R + NKS++S  R+ M+   EA+   K         I    +  
Sbjct: 84  TKKADSAAKRARQAEKRRVYNKSKKSEARTRMKKVLEALEGLKKKTDAQADEIVTVEKLI 143

Query: 52  RKAESVIQKAKSKGIFHGNAASRKVSRLSKRLKGILTSA 90
            +A S I KA      H N  +R+ SRL++R K +    
Sbjct: 144 GEAYSAIDKAVKVKALHKNTGARRKSRLARRKKAVEIHH 182