RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20
[Candidatus Liberibacter asiaticus str. psy62]
         (90 letters)



>d2uubt1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus
          thermophilus [TaxId: 274]}
          Length = 99

 Score = 69.3 bits (170), Expect = 8e-14
 Identities = 33/85 (38%), Positives = 54/85 (63%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SA K  R+  +R L NK+++S++++  + A +    GK EEA +  RKAES+I KA    
Sbjct: 4  SALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGS 63

Query: 66 IFHGNAASRKVSRLSKRLKGILTSA 90
            H NAA+R+ SRL ++++ +L +A
Sbjct: 64 TLHKNAAARRKSRLMRKVRQLLEAA 88


>d2gy9t1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli
          [TaxId: 562]}
          Length = 83

 Score = 64.3 bits (157), Expect = 2e-12
 Identities = 23/81 (28%), Positives = 43/81 (53%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65
          SAKK   +  +    N SRRS +R+F++    AI  G    A +A  + + ++ +  +KG
Sbjct: 2  SAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQAAKG 61

Query: 66 IFHGNAASRKVSRLSKRLKGI 86
          + H N A+R  + L+ ++  +
Sbjct: 62 LIHKNKAARHKANLTAQINKL 82


>d1uc2a_ d.261.1.1 (A:) Hypothetical protein PH1602 {Archaeon
           Pyrococcus horikoshii [TaxId: 53953]}
          Length = 480

 Score = 27.7 bits (61), Expect = 0.25
 Identities = 15/71 (21%), Positives = 28/71 (39%), Gaps = 6/71 (8%)

Query: 9   KMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKGIFH 68
            + RK A R       R  + +   +   A      EEA  A +  ++V++     GI  
Sbjct: 408 VLSRKAATRQYRGDRIRQELLNRGIYVRAASMRVVAEEAPGAYKNVDNVVKVVSEAGI-- 465

Query: 69  GNAASRKVSRL 79
               ++ V+R+
Sbjct: 466 ----AKLVARM 472


>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase
          subunit A {Staphylococcus aureus [TaxId: 1280]}
          Length = 485

 Score = 26.7 bits (58), Expect = 0.49
 Identities = 9/70 (12%), Positives = 22/70 (31%), Gaps = 9/70 (12%)

Query: 6  SAKKMIRKIARRTLINKSRRSSVRSFMRHANE------AITFGKIEEATEACRKAESVIQ 59
          S + ++  I  + +        V+       E      +      E A +  ++ + +  
Sbjct: 7  SVENLLTLIKDKKI---KPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQA 63

Query: 60 KAKSKGIFHG 69
          K +  G   G
Sbjct: 64 KDQMDGKLFG 73


>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic
          domain {Trichoderma reesei [TaxId: 51453]}
          Length = 488

 Score = 25.0 bits (54), Expect = 1.9
 Identities = 4/20 (20%), Positives = 12/20 (60%)

Query: 16 RRTLINKSRRSSVRSFMRHA 35
          +R   N +R ++V++  + +
Sbjct: 1  KRGSPNPTRAAAVKAAFQTS 20


>d1vh6a_ a.24.19.1 (A:) Flagellar export chaperone FliS {Bacillus
          subtilis [TaxId: 1423]}
          Length = 102

 Score = 24.4 bits (53), Expect = 3.0
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 30 SFMRHANEAITFGKIEEATEACRKAESVIQKAKS 63
           F+R A +AI    +E   E   KA+++IQ+   
Sbjct: 16 KFIRLAAQAIENDDMERKNENLIKAQNIIQELNF 49


>d1dhsa_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo
           sapiens) [TaxId: 9606]}
          Length = 361

 Score = 22.9 bits (49), Expect = 8.8
 Identities = 5/14 (35%), Positives = 10/14 (71%)

Query: 36  NEAITFGKIEEATE 49
           +EA+++GKI    +
Sbjct: 314 DEAVSWGKIRVDAQ 327


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.316    0.124    0.319 

Gapped
Lambda     K      H
   0.267   0.0694    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 270,934
Number of extensions: 9748
Number of successful extensions: 40
Number of sequences better than 10.0: 1
Number of HSP's gapped: 40
Number of HSP's successfully gapped: 16
Length of query: 90
Length of database: 2,407,596
Length adjustment: 54
Effective length of query: 36
Effective length of database: 1,666,176
Effective search space: 59982336
Effective search space used: 59982336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.0 bits)