254780627

254780627

chromosomal replication initiation protein

GeneID in NCBI database:8209627Locus tag:CLIBASIA_02570
Protein GI in NCBI database:254780627Protein Accession:YP_003065040.1
Gene range:-(643376, 644884)Protein Length:502aa
Gene description:chromosomal replication initiation protein
COG prediction:none
KEGG prediction:dnaA; chromosomal replication initiation protein; K02313 chromosomal replication initiator protein
SEED prediction:Chromosomal replication initiator protein DnaA
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE
ccHHHHHHHHHHccccccccccccccHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHccEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHcccHHHHHHHHccccEEEEEccHHcccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHcHHHHHHHccccccHHHHHHcHHHHHHHHHHHHHHHccccHHcHHEccccHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccHHHHHHHHHHHHcccccccccccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHccHHHHHHHHHHcHcEEEHHHHHHHccccHHHHHHHHHHHHHHcccEEEEEcccccHHcccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccEEcHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcc
MQLREVAACIQENDVeiaektpnvdvdkrclevNCESIFTIVSSRlknqvgpdvyaSWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSValpsvektasspsitklspintniskspiilgkqtispvfgspldsrfvfstfiegssNRVALTAAQSIaevdshgyttvrlnplFIHASVGLGKTHLLQAIANAsikrqpnlrVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVaaadrppselesldprirsrlqggvsvplglhdYEMRFSILKNRLAisqkedpklninEEVLMHVARTVTTSGRELDGAFNQLvfrhsfapiLTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNIsrndllsnrrvrtvvRPRQVAMYLSkimtprsfpeigrrfgdrdhTTVLHAVRKVEKMLETDITLKKEVELLKRLISE
MQLREVAAciqendveiaektpnvdvdkrcLEVNCESIFTivssrlknqVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALpsvektasspsitklspintnISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANasikrqpnlrVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADrppselesldprirsrlqggvsvplglHDYEMRFSILKNRLaisqkedpklnineeVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVntgetkkmrIEDIQRMVAKHynisrndllsnrrvrtvvrprqvamylskimtprsfpeigrrfgdrdhTTVLHAVRKVekmletditlkkEVELLKRLISE
MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNrrvrtvvrprqvAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE
************************************SIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILV**********************************************LDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAI*Q*EDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLE**ITLKKEVELLKRLI**
MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALP**********ITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQ************ESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE
*QLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSV*****************************************SPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLIS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE
MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE
MQLREVAACIQENDVEIAEKTPNVDVDKRCLEVNCESIFTIVSSRLKNQVGPDVYASWFQRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALPSVEKTASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEEVLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQRMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHAVRKVEKMLETDITLKKEVELLKRLISE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target502 chromosomal replication initiation protein [Candidatus
315121828507 chromosomal replication initiation protein [Candidatus 1 0.0
222084650516 chromosomal replication initiator protein DnaA [Agrobac 1 1e-177
86356015516 chromosomal replication initiation protein [Rhizobium e 1 1e-176
116250144482 chromosomal replication initiation protein [Rhizobium l 1 1e-175
190890027516 chromosomal replication initiator protein [Rhizobium et 1 1e-175
241202756516 chromosomal replication initiation protein [Rhizobium l 1 1e-174
209547613516 chromosomal replication initiation protein [Rhizobium l 1 1e-174
222147316524 chromosomal replication initiation protein [Agrobacteri 1 1e-172
159184258520 chromosomal replication initiation protein [Agrobacteri 1 1e-171
38257685487 RecName: Full=Chromosomal replication initiator protein 1 1e-171
>gi|315121828|ref|YP_004062317.1| chromosomal replication initiation protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 507 Back     alignment and organism information
 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/507 (85%), Positives = 460/507 (90%), Gaps = 5/507 (0%)

Query: 1   MQLREVAACIQENDVEIAEKTPNVDVDKR-CLEVNCESIFTIVSSRLKNQVGPDVYASWF 59
           MQ R ++ CIQ+ND E+  KT N+  D   CLE+ CESIF IVSSRLK  VGPDVYASWF
Sbjct: 1   MQPRGISVCIQKNDDEVPVKTSNMSADTAGCLEIKCESIFKIVSSRLKANVGPDVYASWF 60

Query: 60  QRLKFHSVLHNIVHLSVPTNFLKAWIKNRYLETITKLFQEEHSRIQGVEILVRSVALPSV 119
           QRLKFHSV HN+VHLSVPTNFLKAWIKNRYLETITKLFQEE SR+QGVEILVRS AL  V
Sbjct: 61  QRLKFHSVSHNVVHLSVPTNFLKAWIKNRYLETITKLFQEESSRVQGVEILVRSAALVPV 120

Query: 120 --EKT--ASSPSITKLSPINTNISKSPIILGKQTISPVFGSPLDSRFVFSTFIEGSSNRV 175
             EK+   ++ S TK S I+TN  K+  I GKQTI+PV GSPLDSRFVFSTFI+G SNRV
Sbjct: 121 PSEKSIFPATSSTTKSSTISTNTGKTIAITGKQTINPVLGSPLDSRFVFSTFIDGPSNRV 180

Query: 176 ALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAE 235
           ALTAAQ+IAEVDSHG TTVRLNPLFIHASVGLGKTHLLQ+IANA+IKRQPNLRVVYLTAE
Sbjct: 181 ALTAAQNIAEVDSHGCTTVRLNPLFIHASVGLGKTHLLQSIANAAIKRQPNLRVVYLTAE 240

Query: 236 YFMWRFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVV 295
           YFMWRFASAIRDN ALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVV
Sbjct: 241 YFMWRFASAIRDNHALNLKDSLRNIDLLLIDDMQFLQGKLIQHEFCHLLNSLLDSAKQVV 300

Query: 296 AAADRPPSELESLDPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQKEDPKLNINEE 355
           AAADRPPSELESLDPRIRSRLQGGV+VPLG HDY+MR SILKNRLAISQKE+P LNINEE
Sbjct: 301 AAADRPPSELESLDPRIRSRLQGGVAVPLGSHDYDMRLSILKNRLAISQKENPTLNINEE 360

Query: 356 VLMHVARTVTTSGRELDGAFNQLVFRHSFAPILTAEIADELLSHLVNTGETKKMRIEDIQ 415
           VL HVART+TTSGRELDGAFNQLVFRHSF PILT EI +ELLSHLV+TGETKKMRIEDIQ
Sbjct: 361 VLTHVARTITTSGRELDGAFNQLVFRHSFEPILTVEIVEELLSHLVSTGETKKMRIEDIQ 420

Query: 416 RMVAKHYNISRNDLLSNRRVRTVVRPRQVAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHA 475
           RMVAKHYNISRNDLLSNRR+RTVVRPRQ+AMYLSKIMTPRSFPEIGRRFGDRDHTTVLHA
Sbjct: 421 RMVAKHYNISRNDLLSNRRIRTVVRPRQIAMYLSKIMTPRSFPEIGRRFGDRDHTTVLHA 480

Query: 476 VRKVEKMLETDITLKKEVELLKRLISE 502
           VRKV K+LETDITLKKEVELLKRLISE
Sbjct: 481 VRKVGKLLETDITLKKEVELLKRLISE 507



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084650|ref|YP_002543179.1| chromosomal replication initiator protein DnaA [Agrobacterium radiobacter K84] Length = 516 Back     alignment and organism information
>gi|86356015|ref|YP_467907.1| chromosomal replication initiation protein [Rhizobium etli CFN 42] Length = 516 Back     alignment and organism information
>gi|116250144|ref|YP_765982.1| chromosomal replication initiation protein [Rhizobium leguminosarum bv. viciae 3841] Length = 482 Back     alignment and organism information
>gi|190890027|ref|YP_001976569.1| chromosomal replication initiator protein [Rhizobium etli CIAT 652] Length = 516 Back     alignment and organism information
>gi|241202756|ref|YP_002973852.1| chromosomal replication initiation protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 516 Back     alignment and organism information
>gi|209547613|ref|YP_002279530.1| chromosomal replication initiation protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 516 Back     alignment and organism information
>gi|222147316|ref|YP_002548273.1| chromosomal replication initiation protein [Agrobacterium vitis S4] Length = 524 Back     alignment and organism information
>gi|159184258|ref|NP_353356.2| chromosomal replication initiation protein [Agrobacterium tumefaciens str. C58] Length = 520 Back     alignment and organism information
>gi|38257685|sp|Q8UIH1|DNAA_AGRT5 RecName: Full=Chromosomal replication initiator protein DnaA Length = 487 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target502 chromosomal replication initiation protein [Candidatus
PRK00149450 PRK00149, dnaA, chromosomal replication initiation prot 1e-156
PRK14088440 PRK14088, dnaA, chromosomal replication initiation prot 2e-57
COG0593408 COG0593, DnaA, ATPase involved in DNA replication initi 1e-105
TIGR00362405 TIGR00362, DnaA, chromosomal replication initiator prot 1e-131
pfam00308219 pfam00308, Bac_DnaA, Bacterial dnaA protein 2e-72
PRK14086617 PRK14086, dnaA, chromosomal replication initiation prot 1e-59
PRK14087450 PRK14087, dnaA, chromosomal replication initiation prot 2e-44
PRK12422445 PRK12422, PRK12422, chromosomal replication initiation 1e-41
cd0657190 cd06571, Bac_DnaA_C, C-terminal domain of bacterial Dna 2e-32
pfam0829970 pfam08299, Bac_DnaA_C, domain 7e-26
PRK06030124 PRK06030, PRK06030, hypothetical protein; Provisional 1e-07
smart0076060 smart00760, Bac_DnaA_C, Bacterial dnaA protein helix-tu 7e-21
TIGR03420226 TIGR03420, DnaA_homol_Hda, DnaA regulatory inactivator 1e-15
PRK05642234 PRK05642, PRK05642, DNA replication initiation factor; 3e-08
PRK08084235 PRK08084, PRK08084, DNA replication initiation factor; 4e-04
PRK08903227 PRK08903, PRK08903, DnaA regulatory inactivator Hda; Va 0.003
PRK06835329 PRK06835, PRK06835, DNA replication protein DnaC; Valid 6e-09
COG1484254 COG1484, DnaC, DNA replication protein [DNA replication 2e-07
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 4e-07
smart00382148 smart00382, AAA, ATPases associated with a variety of c 7e-04
PRK06893229 PRK06893, PRK06893, DNA replication initiation factor; 0.001
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validated 3e-04
>gnl|CDD|178902 PRK00149, dnaA, chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>gnl|CDD|172578 PRK14088, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|30938 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161840 TIGR00362, DnaA, chromosomal replication initiator protein DnaA Back     alignment and domain information
>gnl|CDD|144046 pfam00308, Bac_DnaA, Bacterial dnaA protein Back     alignment and domain information
>gnl|CDD|184497 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|172577 PRK14087, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|183521 PRK12422, PRK12422, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|119330 cd06571, Bac_DnaA_C, C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>gnl|CDD|149380 pfam08299, Bac_DnaA_C, domain Back     alignment and domain information
>gnl|CDD|180356 PRK06030, PRK06030, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|128999 smart00760, Bac_DnaA_C, Bacterial dnaA protein helix-turn-helix domain Back     alignment and domain information
>gnl|CDD|163254 TIGR03420, DnaA_homol_Hda, DnaA regulatory inactivator Hda Back     alignment and domain information
>gnl|CDD|168147 PRK05642, PRK05642, DNA replication initiation factor; Validated Back     alignment and domain information
>gnl|CDD|181224 PRK08084, PRK08084, DNA replication initiation factor; Provisional Back     alignment and domain information
>gnl|CDD|181578 PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>gnl|CDD|180719 PRK06835, PRK06835, DNA replication protein DnaC; Validated Back     alignment and domain information
>gnl|CDD|31673 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|168719 PRK06893, PRK06893, DNA replication initiation factor; Validated Back     alignment and domain information
>gnl|CDD|181233 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 502 chromosomal replication initiation protein [Candidatus
PRK00149447 dnaA chromosomal replication initiation protein; Review 100.0
PRK12422455 chromosomal replication initiation protein; Provisional 100.0
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 100.0
TIGR00362493 DnaA chromosomal replication initiator protein DnaA; In 100.0
pfam00308219 Bac_DnaA Bacterial dnaA protein. 100.0
PRK08084235 DNA replication initiation factor; Provisional 100.0
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 100.0
PRK05642234 DNA replication initiation factor; Validated 100.0
PRK08903227 hypothetical protein; Validated 100.0
PRK06893229 DNA replication initiation factor; Validated 100.0
PRK08727233 hypothetical protein; Validated 100.0
PRK06620214 hypothetical protein; Validated 100.0
PRK09087226 hypothetical protein; Validated 100.0
PRK00440318 rfc replication factor C small subunit; Reviewed 99.48
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.43
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.32
PRK12402337 replication factor C small subunit 2; Reviewed 99.26
CHL00176 631 ftsH cell division protein; Validated 99.14
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.02
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.99
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.99
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.97
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 98.91
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 98.84
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.83
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 98.81
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.8
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 98.76
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 98.76
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 98.75
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 98.74
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 98.74
PRK11608325 pspF phage shock protein operon transcriptional activat 98.72
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 98.55
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.5
pfam05621302 TniB Bacterial TniB protein. This family consists of se 98.49
PRK10365441 transcriptional regulatory protein ZraR; Provisional 98.44
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 98.41
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 98.4
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.38
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.37
PRK05022510 anaerobic nitric oxide reductase transcription regulato 98.36
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 98.33
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.31
PRK10865 857 protein disaggregation chaperone; Provisional 98.29
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 98.27
PRK10865857 protein disaggregation chaperone; Provisional 98.24
COG1221403 PspF Transcriptional regulators containing an AAA-type 98.17
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 98.16
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 98.16
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 98.15
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 98.12
CHL00095823 clpC Clp protease ATP binding subunit 98.06
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.0
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.0
PRK05564313 DNA polymerase III subunit delta'; Validated 97.99
KOG0735952 consensus 97.91
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.86
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.81
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.8
KOG0731 774 consensus 97.77
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 97.77
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 97.39
PRK09112352 DNA polymerase III subunit delta'; Validated 97.38
COG2204464 AtoC Response regulator containing CheY-like receiver, 97.37
PRK07399314 DNA polymerase III subunit delta'; Validated 97.34
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.32
PRK07471363 DNA polymerase III subunit delta'; Validated 97.3
KOG0741744 consensus 96.62
KOG0991333 consensus 96.25
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 96.18
KOG1970 634 consensus 95.95
COG2842297 Uncharacterized ATPase, putative transposase [General f 95.52
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 95.48
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 93.96
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 92.95
KOG2170344 consensus 91.27
PRK08116262 hypothetical protein; Validated 99.93
PRK07952242 DNA replication protein DnaC; Validated 99.89
PRK06835330 DNA replication protein DnaC; Validated 99.86
PRK06921265 hypothetical protein; Provisional 99.85
PRK12377248 putative replication protein; Provisional 99.81
COG1484254 DnaC DNA replication protein [DNA replication, recombin 99.7
PRK09183258 transposase/IS protein; Provisional 99.59
KOG0744423 consensus 97.88
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 97.5
COG0714329 MoxR-like ATPases [General function prediction only] 96.89
KOG0743457 consensus 96.64
PRK13407334 bchI magnesium chelatase subunit I; Provisional 96.33
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.0
PRK13833323 conjugal transfer protein TrbB; Provisional 95.82
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins 99.93
pfam0829970 Bac_DnaA_C domain. 99.91
PRK06030136 hypothetical protein; Provisional 99.81
PRK13873815 conjugal transfer ATPase TrbE; Provisional 92.36
smart0076060 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix doma 99.75
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 99.74
PRK08939306 primosomal protein DnaI; Reviewed 99.71
KOG1051898 consensus 94.17
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 93.49
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 92.51
PRK08181269 transposase; Validated 99.63
PRK06526254 transposase; Provisional 99.6
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.21
COG1485367 Predicted ATPase [General function prediction only] 98.72
pfam00004131 AAA ATPase family associated with various cellular acti 98.52
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.17
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.93
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 97.75
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 97.6
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.43
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 97.36
pfam00625182 Guanylate_kin Guanylate kinase. 97.25
pfam00493327 MCM MCM2/3/5 family. 97.1
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 97.1
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.08
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.03
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 96.94
KOG0742630 consensus 96.89
KOG2228408 consensus 96.87
KOG0726440 consensus 96.82
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.77
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.76
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.6
PRK13695174 putative NTPase; Provisional 96.57
PRK06090319 DNA polymerase III subunit delta'; Validated 96.56
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.51
PRK06871324 DNA polymerase III subunit delta'; Validated 96.5
PRK07993334 DNA polymerase III subunit delta'; Validated 96.5
PRK05707328 DNA polymerase III subunit delta'; Validated 96.49
PRK09354350 recA recombinase A; Provisional 96.48
COG3910233 Predicted ATPase [General function prediction only] 96.47
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.42
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.32
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.28
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.07
PRK11784333 tRNA 2-selenouridine synthase; Provisional 96.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 95.97
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 95.75
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 95.38
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 95.28
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 95.23
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.19
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.1
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 94.64
PTZ00301210 uridine kinase; Provisional 94.63
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 94.62
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 94.6
smart00350509 MCM minichromosome maintenance proteins. 94.58
KOG0066 807 consensus 94.37
PRK08699325 DNA polymerase III subunit delta'; Validated 94.3
PRK05636507 replicative DNA helicase; Provisional 94.19
PRK06964342 DNA polymerase III subunit delta'; Validated 94.11
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.09
PRK04040189 adenylate kinase; Provisional 93.59
PHA00729228 NTP-binding motif containing protein 93.42
PRK05541176 adenylylsulfate kinase; Provisional 92.99
PRK07261171 topology modulation protein; Provisional 92.72
KOG0609542 consensus 92.7
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 92.55
PRK06321472 replicative DNA helicase; Provisional 92.04
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.98
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 91.75
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 91.37
PRK08118167 topology modulation protein; Reviewed 90.83
pfam02572172 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 90.61
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 90.53
PRK06749428 replicative DNA helicase; Provisional 90.45
PRK13342417 recombination factor protein RarA; Reviewed 99.54
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.31
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 99.2
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.85
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.8
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.62
KOG0989346 consensus 98.61
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.55
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 95.16
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 92.62
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.43
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.24
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.7
CHL00095 823 clpC Clp protease ATP binding subunit 98.66
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.21
KOG0741 744 consensus 97.96
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 97.96
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.9
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.87
KOG0736 953 consensus 97.42
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 97.28
PRK04195403 replication factor C large subunit; Provisional 99.35
PRK03992390 proteasome-activating nucleotidase; Provisional 99.22
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 99.19
KOG0735 952 consensus 99.11
KOG0730693 consensus 98.83
CHL00195491 ycf46 Ycf46; Provisional 98.78
KOG0737386 consensus 98.28
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.03
PRK07452326 DNA polymerase III subunit delta; Validated 97.94
KOG0728404 consensus 97.77
KOG1514767 consensus 97.76
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 97.22
pfam00931285 NB-ARC NB-ARC domain. 97.08
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 96.89
PRK00300208 gmk guanylate kinase; Provisional 96.83
PRK09302 501 circadian clock protein KaiC; Reviewed 95.93
PRK05818262 DNA polymerase III subunit delta'; Validated 94.45
PRK07914320 hypothetical protein; Reviewed 94.41
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.08
PRK05629331 hypothetical protein; Validated 92.88
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 98.91
smart00382148 AAA ATPases associated with a variety of cellular activ 98.22
KOG2383467 consensus 98.18
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.88
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 97.7
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.11
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 96.94
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 96.89
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 96.78
PTZ00243 1560 ABC transporter; Provisional 96.73
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 96.69
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.65
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.65
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.64
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.62
PRK09302501 circadian clock protein KaiC; Reviewed 96.46
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 96.31
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.3
PRK11823454 DNA repair protein RadA; Provisional 96.29
PRK04296197 thymidine kinase; Provisional 96.22
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.21
PTZ00293284 thymidine kinase; Provisional 95.93
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 95.79
PRK04301318 radA DNA repair and recombination protein RadA; Validat 95.76
pfam00265175 TK Thymidine kinase. 95.75
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 95.64
pfam07726131 AAA_3 ATPase family associated with various cellular ac 95.55
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.48
KOG0054 1381 consensus 95.25
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 95.17
PHA02244383 ATPase-like protein 95.1
PRK10875 607 recD exonuclease V subunit alpha; Provisional 95.08
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.01
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 94.82
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 94.76
PRK09376416 rho transcription termination factor Rho; Provisional 94.57
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 94.24
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 94.09
PTZ00035350 Rad51; Provisional 93.96
KOG3347176 consensus 93.87
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 93.6
PRK13826 1102 Dtr system oriT relaxase; Provisional 93.54
KOG0952 1230 consensus 93.51
COG4240300 Predicted kinase [General function prediction only] 93.16
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 92.75
PRK05580 699 primosome assembly protein PriA; Validated 92.35
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 91.81
KOG3125234 consensus 91.67
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 91.33
COG1100219 GTPase SAR1 and related small G proteins [General funct 90.72
KOG0730 693 consensus 98.87
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.7
KOG0740428 consensus 98.65
KOG0733 802 consensus 98.37
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.36
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.33
KOG0734 752 consensus 98.29
CHL00181287 cbbX CbbX; Provisional 98.26
KOG0738491 consensus 98.04
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.03
PTZ00112650 origin recognition complex 1 protein; Provisional 97.92
KOG1969 877 consensus 97.71
KOG0733802 consensus 97.61
KOG0651388 consensus 97.55
KOG0727408 consensus 97.31
pfam06144172 DNA_pol3_delta DNA polymerase III, delta subunit. DNA p 97.2
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.15
PRK08058329 DNA polymerase III subunit delta'; Validated 97.15
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 97.13
KOG1968 871 consensus 97.03
KOG0736953 consensus 96.91
PRK08769319 DNA polymerase III subunit delta'; Validated 96.87
KOG2004 906 consensus 96.86
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.81
KOG0739439 consensus 96.57
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 96.28
PRK07940395 DNA polymerase III subunit delta'; Validated 95.87
KOG0729435 consensus 95.71
KOG0732 1080 consensus 95.46
KOG2543438 consensus 94.99
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 94.79
PRK05917290 DNA polymerase III subunit delta'; Validated 94.64
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 94.28
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 93.98
KOG0652424 consensus 93.73
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 93.26
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 92.79
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 92.42
PRK06672341 hypothetical protein; Validated 98.82
PRK06672341 hypothetical protein; Validated 98.74
pfam11490180 DNA_pol3_alph_N DNA polymerase III polC-type N-terminus 96.25
PRK00448 1436 polC DNA polymerase III PolC; Validated 93.57
COG1373 398 Predicted ATPase (AAA+ superfamily) [General function p 98.46
KOG2028554 consensus 98.33
PRK05574336 holA DNA polymerase III subunit delta; Reviewed 97.9
KOG2035351 consensus 97.66
PRK13531 498 regulatory ATPase RavA; Provisional 96.34
PRK07132303 DNA polymerase III subunit delta'; Validated 96.02
TIGR02773 1192 addB_Gpos ATP-dependent nuclease subunit B; InterPro: I 95.71
PRK08487328 DNA polymerase III subunit delta; Validated 91.82
KOG2227529 consensus 98.19
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 98.12
PRK06067241 flagellar accessory protein FlaH; Validated 97.47
pfam06745231 KaiC KaiC. This family represents a conserved region wi 97.46
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.19
PRK04328250 hypothetical protein; Provisional 97.05
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 96.8
smart00487201 DEXDc DEAD-like helicases superfamily. 96.48
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.38
PRK10536262 hypothetical protein; Provisional 96.06
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.29
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.08
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 94.87
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereus E33 94.67
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 94.43
KOG1803 649 consensus 94.42
KOG0243 1041 consensus 94.36
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle po 94.34
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 94.24
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 93.86
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like subgro 93.78
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Microtubu 93.72
KOG0242 675 consensus 93.67
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 93.31
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like group. K 93.18
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup 93.1
KOG0240 607 consensus 93.0
PRK10790593 putative multidrug transporter membrane\ATP-binding com 92.97
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain 92.92
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_lik 92.9
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Me 92.79
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup 92.69
KOG4280 574 consensus 92.68
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subg 92.62
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 92.54
COG4178604 ABC-type uncharacterized transport system, permease and 92.5
KOG2878282 consensus 92.48
PRK05480209 uridine kinase; Provisional 92.28
KOG0060659 consensus 92.11
PRK10646153 putative ATPase; Provisional 91.94
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup 91.87
pfam00225321 Kinesin Kinesin motor domain. 91.84
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 91.78
PRK03846198 adenylylsulfate kinase; Provisional 91.61
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 91.25
cd00106328 KISc Kinesin motor domain. This catalytic (head) domain 91.16
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 91.14
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-l 91.1
PRK13898800 type IV secretion system ATPase VirB4; Provisional 90.88
smart00488289 DEXDc2 DEAD-like helicases superfamily. 90.72
smart00489289 DEXDc3 DEAD-like helicases superfamily. 90.72
PRK06696227 uridine kinase; Validated 90.72
KOG1942456 consensus 90.53
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 97.62
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.27
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.12
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 95.47
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 95.03
pfam04851103 ResIII Type III restriction enzyme, res subunit. 94.8
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 93.9
PRK05595444 replicative DNA helicase; Provisional 93.15
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 92.52
PRK04841903 transcriptional regulator MalT; Provisional 97.56
PRK02362736 ski2-like helicase; Provisional 93.89
PRK00254717 ski2-like helicase; Provisional 92.94
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.53
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.98
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 96.58
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.48
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 96.25
cd01128249 rho_factor Transcription termination factor rho is a ba 96.17
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.03
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.0
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 95.89
PRK08233182 hypothetical protein; Provisional 95.88
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 95.81
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.69
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 95.69
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.66
PRK12608379 transcription termination factor Rho; Provisional 95.58
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.5
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 95.49
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.48
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.31
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 95.27
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 95.27
CHL00060480 atpB ATP synthase CF1 beta subunit 95.22
PRK13542224 consensus 95.2
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.07
PRK09280466 F0F1 ATP synthase subunit beta; Validated 94.94
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.9
PRK10789569 putative multidrug transporter membrane\ATP-binding com 94.83
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 94.79
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 94.77
PRK07667190 uridine kinase; Provisional 94.68
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 94.44
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 94.26
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 94.26
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 94.23
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 94.17
PRK08927441 fliI flagellum-specific ATP synthase; Validated 94.16
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.07
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 93.96
COG1341398 Predicted GTPase or GTP-binding protein [General functi 93.82
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 93.78
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 93.36
PRK06851368 hypothetical protein; Provisional 93.22
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.19
PRK13700 732 conjugal transfer protein TraD; Provisional 92.98
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 92.92
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 92.89
PRK12678667 transcription termination factor Rho; Provisional 92.64
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 92.61
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 92.61
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 92.57
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 92.5
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 92.47
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 92.15
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 92.15
PRK09270230 frcK putative fructose transport system kinase; Reviewe 92.08
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 91.91
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 91.88
PRK07263453 consensus 91.65
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 91.56
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 91.52
PRK13830818 conjugal transfer protein TrbE; Provisional 91.45
PRK06315442 type III secretion system ATPase; Provisional 91.3
COG3451796 VirB4 Type IV secretory pathway, VirB4 components [Intr 91.22
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 91.07
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 91.02
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 90.93
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 90.69
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 90.66
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 90.51
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 97.49
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.41
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.36
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.26
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.26
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.04
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 94.98
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.79
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.78
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.69
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 94.67
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.63
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 94.34
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 94.06
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 93.96
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 93.95
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 93.94
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 93.44
PRK10535648 macrolide transporter ATP-binding /permease protein; Pr 93.29
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 93.24
PRK10762501 D-ribose transporter ATP binding protein; Provisional 93.17
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 92.79
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 92.55
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.53
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.48
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.3
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 91.83
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 91.18
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 90.75
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.46
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 97.35
COG1466334 HolA DNA polymerase III, delta subunit [DNA replication 97.22
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.99
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.58
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 95.07
KOG1942456 consensus 94.95
PRK04132863 replication factor C small subunit; Provisional 94.6
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.14
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 96.06
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 95.78
PRK09519790 recA recombinase A; Reviewed 95.68
PRK13767 878 ATP-dependent helicase; Provisional 94.92
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 92.71
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 90.95
COG1204 766 Superfamily II helicase [General function prediction on 94.78
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 92.18
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 94.78
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 94.29
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 94.16
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 94.22
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 93.33
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 93.23
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 92.69
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 91.55
PRK01172674 ski2-like helicase; Provisional 92.97
PRK07276290 DNA polymerase III subunit delta'; Validated 91.0
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA; InterPro: IPR001957 The bacterial dnaA protein , , plays an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>pfam00308 Bac_DnaA Bacterial dnaA protein Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08903 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>pfam05621 TniB Bacterial TniB protein Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information