>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.

Probab=93.33 E-value=0.19 Score=30.26 Aligned_cols=70 Identities=11% Similarity=0.081 Sum_probs=37.3 Q ss_pred HHHHHHHCCHHHHHHHHHHCCC--CHHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCCHHHHHHHHCCEEEEECCCC Q ss_conf 9999740310205444453175--069999999999885698799964875676136303457653021157751588 Q gi|254780627|r 253 LKDSLRNIDLLLIDDMQFLQGK--LIQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQGGVSVPLGLHD 328 (502) Q Consensus 253 fr~~~r~~DvLliDDiqfl~gk--~tqee~f~~~n~l~~~gkqiv~tsd~~P~~l~~l~~rL~SR~~~Gl~~~i~~Pd 328 (502) T Consensus 150 ARaLl~~p~IllLDEp--Ts~LD~~te~~i~~~l~~~-~~~~TvI~itHrl-~~~~~-~DrIl-vld~G~Ive~Gt~e 221 (275) T cd03289 150 ARSVLSKAKILLLDEP--SAHLDPITYQVIRKTLKQA-FADCTVILSEHRI-EAMLE-CQRFL-VIEENKVRQYDSIQ 221 (275) T ss_pred HHHHHCCCCEEEEECC--CCCCCHHHHHHHHHHHHHH-CCCCEEEEEECCH-HHHHH-CCEEE-EEECCEEEEECCHH T ss_conf 9999519998999797--6689999999999999997-2999899994388-88986-99999-99899999978989

HHsearch alignment for GI: 254780627 and conserved domain: cd03289