HHsearch alignment for GI: 254780628 and conserved domain: COG0635

>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=690.99  Aligned_cols=371  Identities=40%  Similarity=0.725  Sum_probs=351.0

Q ss_pred             CCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCC-CEEEEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             8549999406511837657730245788662889999999999999876189-505899962888887899999999976
Q gi|254780628|r   17 NSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGP-RSISSIFFGGGTPSLIEPQNIALILDG   95 (395)
Q Consensus        17 ~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~-~~~~~iy~GGGTPs~l~~~~l~~ll~~   95 (395)
T Consensus        33 ~~~slYiHiPFC~~~C~YC~fn~~~~~~~~~~~~Y~~aL~~Ei~~~~~~~~~~~~v~ti~~GGGTPslL~~~~l~~ll~~  112 (416)
T COG0635          33 KPLSLYIHIPFCVSKCPYCDFNSHVTKRGQPVDEYLDALLEEIELVAALLGGQREVKTIYFGGGTPSLLSPEQLERLLKA  112 (416)
T ss_pred             CCCEEEEECCCHHCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHH
T ss_conf             87368887232125088788854534777739999999999999988622788727899976983267799999999999


Q ss_pred             HHHCC-CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCC-CCCCCC
Q ss_conf             64047-6444332113321041002347766303454114323433201345542244313478999986302-444333
Q gi|254780628|r   96 IAKNW-TVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSF  173 (395)
Q Consensus        96 i~~~~-~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~-~~~v~i  173 (395)
T Consensus       113 l~~~~~~~~~~~EitiE~nP~~~~~e~~~~l~~~GvNRiSlGVQsf~~~~lk~lgR~h~~~~~~~a~~~~~~~g~~~in~  192 (416)
T COG0635         113 LRELFNDLDPDAEITIEANPGTVEAEKFKALKEAGVNRISLGVQSFNDEVLKALGRIHDEEEAKEAVELARKAGFTSINI  192 (416)
T ss_pred             HHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99972357888279995088866899999999829877986014599899997478887899999999998638974788


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             21000258543221112788753180012346468825960001454498021103567889998655788709624236
Q gi|254780628|r  174 DLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI  253 (395)
Q Consensus       174 Dli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~~~GY~~Yei  253 (395)
T Consensus       193 DLIyglP~QT~~~~~~~l~~a~~l~pdhis~y~L~~~p~t~~~~~~~~~~-~lP~~d~~~~~~~~~~e~L~~~Gy~~yei  271 (416)
T COG0635         193 DLIYGLPGQTLESLKEDLEQALELGPDHLSLYSLAIEPGTKFAQRKIKGK-ALPDEDEKADMYELVEELLEKAGYRQYEI  271 (416)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEECCCCHHHHHCCCCC-CCCCHHHHHHHHHHHHHHHHHCCCHHEEC
T ss_conf             72438999999999999999983499878646268658856766233577-89986899999999999999779641061


Q ss_pred             CCHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHH
Q ss_conf             74343101101332112444123204320011578861578654247025778775389633322454999989999999
Q gi|254780628|r  254 SNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMM  333 (395)
Q Consensus       254 s~fak~~~~s~hn~~Yw~~~d~iG~G~GA~S~l~~~~~~~~~~~~~~~~~Y~~~i~~~~~p~~~~~~Ls~~e~~~e~l~~  333 (395)
T Consensus       272 snfa~~~~e~~hNl~yw~~~~~lGiG~gA~g~~~~----~~~~n~~~~~~y~~~~~~~~~~~~~~~~l~~~d~~~e~~i~  347 (416)
T COG0635         272 SNFAKPGGECRHNLQYWETKDYLGIGAGAHGRIGG----TRYQNKKNLKTYLEAVDEGGLPLVEGEELTPDDLIREALIL  347 (416)
T ss_pred             HHHCCCCHHHHHHHCCCCCCCEEEECCCCEEECCC----CHHHCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHH
T ss_conf             23127647777665156479717866770001344----24343469999999985277643443317888999999998


Q ss_pred             HHHHCCCCCHHHHHHHHCCCHH----HHHHHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHHHC
Q ss_conf             6562379988899988389964----999999998799498559899995675898999999861
Q gi|254780628|r  334 GLRLREGISVKDWEMLAGRNLD----IECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA  394 (395)
Q Consensus       334 ~LR~~~Gid~~~~~~~fg~~~~----~~~~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~l~  394 (395)
T Consensus       348 gLr~~~gv~~~~~~~~~~~-~~~~~~~~~l~~~~~~Gll~-~~~~~~~lt~~g~~~~~~i~~~f~  410 (416)
T COG0635         348 GLRLNFGVDLAELEERFGI-FKFAEILELLAELIADGLLE-LDGDRLRLTEKGRLLLRSIAEAFD  410 (416)
T ss_pred             HHHHHCCCCHHHHHHHHCC-CHHHHHHHHHHHHHHCCCEE-ECCCEEEECCCHHHHHHHHHHHHH
T ss_conf             6577448678999998486-05666799999998689689-639879988530647999999999