HHsearch alignment for GI: 254780628 and conserved domain: COG1533

>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair].
Probab=98.09  E-value=6.8e-05  Score=52.58  Aligned_cols=194  Identities=13%  Similarity=0.141  Sum_probs=124.4

Q ss_pred             HCCCCCCCEEEEEECCC--CCCCCCCCCCEEEECCC-C-----CCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCC
Q ss_conf             42889885499994065--11837657730245788-6-----6288999999999999987618950589996288888
Q gi|254780628|r   11 MTGQGSNSLGVYVHWPF--CVKKCPYCDFNSHVRRY-K-----VGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPS   82 (395)
Q Consensus        11 ~~~~~~~~l~lYihiPF--C~~~C~yC~f~~~~~~~-~-----~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs   82 (395)
T Consensus        21 ~~~~~~~~~~y~in-py~GC~h~C~YCYa~~~~~~~~~~~~~v~vk~n~~e~l~~el~~-----~~~k~~~i~is~~TDp   94 (297)
T COG1533          21 LNKSLLCPFDYTLN-PYRGCSHGCIYCYARPMHGYLPKSPTKVNVKENLLELLERELRK-----PGPKRTVIAISSVTDP   94 (297)
T ss_pred             CCCCCCCCCCEECC-CCCCCCCCCCEEECCCCCCCCCCCCCEEEEHHHHHHHHHHHHHH-----CCCCCEEEEEECCCCC
T ss_conf             36677898752337-74787788841336201466567860554015699999988752-----4678559998546888


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCCC--CCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHH-CCCCCHHHHH
Q ss_conf             789999999997664047644433211332--1041002347766303454114323433201345542-2443134789
Q gi|254780628|r   83 LIEPQNIALILDGIAKNWTVSSNVEITIEA--NPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLG-RNHNASEAIA  159 (395)
Q Consensus        83 ~l~~~~l~~ll~~i~~~~~~~~~~e~t~E~--~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~-R~~~~~~~~~  159 (395)
T Consensus        95 yqp~E~~~~ltR~ilei~~~~-~~~v~I~TKS~lv~RDld~l~~~~~~~~v~V~~Sitt~d~~l~k~~EP~apsp~~Ri~  173 (297)
T COG1533          95 YQPIEKEYRLTRKILEILLKY-GFPVSIVTKSALVLRDLDLLLELAERGKVRVAVSITTLDEELAKILEPRAPSPEERLE  173 (297)
T ss_pred             CCCHHHHHHHHHHHHHHHHHC-CCCEEEEECCCCHHCCHHHHHHHCCCCCEEEEEEEECCCHHHHHHCCCCCCCHHHHHH
T ss_conf             856477878999999998853-9967999777410102789984011265189999516848889865899969899999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             9998630244433321000258543221112788753180012346468825
Q gi|254780628|r  160 AIHLARNIFPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEK  211 (395)
Q Consensus       160 ~~~~~~~~~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~  211 (395)
T Consensus       174 al~~l~eaGi~~~v~v~PIiP~~~d~e~e~~l~~~~~ag~~~v~~~~l~~~~  225 (297)
T COG1533         174 ALKELSEAGIPVGLFVAPIIPGLNDEELERILEAAAEAGARVVVYGTLRLRL  225 (297)
T ss_pred             HHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCH
T ss_conf             9999998798489998553078875889999999997577413631330457