HHsearch alignment for GI: 254780628 and conserved domain: COG2108

>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only].
Probab=97.62  E-value=0.00051  Score=46.77  Aligned_cols=165  Identities=15%  Similarity=0.235  Sum_probs=103.8

Q ss_pred             CCCCCCCCCCCCCEEEE------CCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             06511837657730245------788662889999999999999876189505899962888887899999999976640
Q gi|254780628|r   25 WPFCVKKCPYCDFNSHV------RRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAK   98 (395)
Q Consensus        25 iPFC~~~C~yC~f~~~~------~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~~i~~   98 (395)
T Consensus        35 TG~C~~~CfYCPvs~~r~gkdviyaNErpV~-~~eDii~ea~~~~a~--Ga-----siTGGdPl~-~ieR~~~~ir~LK~  105 (353)
T COG2108          35 TGLCNRSCFYCPVSDERKGKDVIYANERPVK-SVEDIIEEAKLMDAL--GA-----SITGGDPLL-EIERTVEYIRLLKD  105 (353)
T ss_pred             ECCCCCCCCCCCCCHHHCCCCCEEECCCCCC-CHHHHHHHHHHHCCC--CC-----CCCCCCHHH-HHHHHHHHHHHHHH
T ss_conf             5566898525768777648863311563147-578899999972466--65-----332787489-99999999999987


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             47644433211332104100234776630345411432343320134554224431347899998630244433321000
Q gi|254780628|r   99 NWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYA  178 (395)
Q Consensus        99 ~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~~~~v~iDli~G  178 (395)
T Consensus       106 efG--~~fHiHLYT~g~~~~~e~l~~L~eAGLDEIRfHp~~~~~---------~~~e~~i~~l~~A~~~g~dvG~E-iPa  173 (353)
T COG2108         106 EFG--EDFHIHLYTTGILATEEALKALAEAGLDEIRFHPPRPGS---------KSSEKYIENLKIAKKYGMDVGVE-IPA  173 (353)
T ss_pred             HHC--CCEEEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC---------CCCHHHHHHHHHHHHHCCCCEEE-CCC
T ss_conf             635--320599840665688899999986798759946897211---------23189999999999828551043-278


Q ss_pred             CCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             258543221112788753180012346468825
Q gi|254780628|r  179 LPKQTMTQWEMELQRALSYAVDHLSLYQLTIEK  211 (395)
Q Consensus       179 lPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~  211 (395)
T Consensus       174 ipg~e~-~i~e~~~~~~~~~~~FlNiNELE~sE  205 (353)
T COG2108         174 IPGEEE-AILEFAKALDENGLDFLNINELEFSE  205 (353)
T ss_pred             CCCHHH-HHHHHHHHHHHCCCCEEEEEEEEECC
T ss_conf             865688-99999999876066534210044052