HHsearch alignment for GI: 254780628 and conserved domain: COG2896

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism].
Probab=98.74  E-value=9.9e-08  Score=71.36  Aligned_cols=169  Identities=17%  Similarity=0.265  Sum_probs=117.4

Q ss_pred             CCCCCCCCCCCCCEE-EECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             065118376577302-4578866288999999999999987618950589996288888789999999997664047644
Q gi|254780628|r   25 WPFCVKKCPYCDFNS-HVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVS  103 (395)
Q Consensus        25 iPFC~~~C~yC~f~~-~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~~i~~~~~~~  103 (395)
T Consensus        18 TdrCNfrC~YCm~eg~~~~~~~---~~~Ls--~eei~~~~~~~~~~Gv~kvRlTGGEPll--R~dl~eIi~~l~~~-~--   87 (322)
T COG2896          18 TDRCNFRCTYCMPEGPLAFLPK---EELLS--LEEIRRLVRAFAELGVEKVRLTGGEPLL--RKDLDEIIARLARL-G--   87 (322)
T ss_pred             ECCCCCCCCCCCCCCCCCCCCC---CCCCC--HHHHHHHHHHHHHCCCCEEEEECCCCHH--HCCHHHHHHHHHHC-C--
T ss_conf             2673774644688886566765---45489--9999999999997396458971898313--32799999987434-6--


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCCCCC---CCCCCCCCCC
Q ss_conf             4332113321041002347766303454114323433201345542244313478999986302444---3332100025
Q gi|254780628|r  104 SNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPR---MSFDLIYALP  180 (395)
Q Consensus       104 ~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~~~~---v~iDli~GlP  180 (395)
T Consensus        88 -~~~islTTN-G~~L~~~a~~Lk~AGl~rVNVSLDsld~e~f~~IT~~~~~~~Vl~GI~~A~~~Gl~pVKlN~Vv~---k  162 (322)
T COG2896          88 -IRDLSLTTN-GVLLARRAADLKEAGLDRVNVSLDSLDPEKFRKITGRDRLDRVLEGIDAAVEAGLTPVKLNTVLM---K  162 (322)
T ss_pred             -CCEEEEECC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEEE---C
T ss_conf             -442887445-67679999999975986899503449989999886789299999999999976998557888984---6


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCEEEEEEEE
Q ss_conf             85432211127887531800123464688
Q gi|254780628|r  181 KQTMTQWEMELQRALSYAVDHLSLYQLTI  209 (395)
Q Consensus       181 gqt~e~~~~~l~~~~~l~p~~is~Y~l~i  209 (395)
T Consensus       163 gvNd~ei~~l~e~~~~~~~-~lrfIE~m~  190 (322)
T COG2896         163 GVNDDEIEDLLEFAKERGA-QLRFIELMP  190 (322)
T ss_pred             CCCHHHHHHHHHHHHHCCC-CEEEEEEEE
T ss_conf             9887899999999852698-447999866