HHsearch alignment for GI: 254780628 and conserved domain: PRK05904

>PRK05904 coproporphyrinogen III oxidase; Provisional.
Probab=100.00  E-value=0  Score=672.32  Aligned_cols=349  Identities=27%  Similarity=0.465  Sum_probs=303.8

Q ss_pred             CCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             98854999940651183765773024578866288999999999999987618950589996288888789999999997
Q gi|254780628|r   15 GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILD   94 (395)
Q Consensus        15 ~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~   94 (395)
T Consensus         3 ~~k~~~LYIHIPFC~~kC~YCdF~s~~~~~~--~~~~~~~~~~el~~~~~~~~~~~i~TIyfGGGTPSlL~~~~l~~ll~   80 (353)
T PRK05904          3 NKKTKHLYIHIPFCQYICTFCDFKRILKTPQ--TKKIFKDFLKNIKMHIKNFKIKQFKTIYLGGGTPNCLNDQLLDILLS   80 (353)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCCCCCCCCC--CHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHCCHHHHHHHHH
T ss_conf             8886669998089987089998984188768--59999999999999987647995448998998602089999999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCC-CCCCCC
Q ss_conf             6640476444332113321041002347766303454114323433201345542244313478999986302-444333
Q gi|254780628|r   95 GIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRMSF  173 (395)
Q Consensus        95 ~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~-~~~v~i  173 (395)
T Consensus        81 ~i~~~--~~~~~EiTiEaNP~~~~~ekL~~lk~~GVNRiSlGVQSf~d~~Lk~LGR~H~~~~~~~ai~~~r~~Gf~nIsi  158 (353)
T PRK05904         81 TIKPY--VDNNCEFTIECNPELITQSQINLLKKNKVNRISLGVQSMNNNILKQLNRTHTIQDSKEAINLLHKNGIYNISC  158 (353)
T ss_pred             HHHHH--CCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99976--3878359998651448789999999649876888745599899998389998999999999999819973600


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             21000258543221112788753180012346468825960001454498021103567889998655788709624236
Q gi|254780628|r  174 DLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEI  253 (395)
Q Consensus       174 Dli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~~~GY~~Yei  253 (395)
T Consensus       159 DLIyGlPgQT~~~~~~~L~~~l~l~p~HiS~Y~LtiE~gT~~~~~~~-----~~~~d~~~~~~~~~~~~L~~~Gy~~YEI  233 (353)
T PRK05904        159 DFLYCLPILKLKDLDEVFNFILKHKINHISFYSLEIKEGSILKKYHY-----TIDEDKEAEQLNYIKAKFNKLNYKRYEV  233 (353)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHCCCCC-----CCCCHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             42635999999999999999996599917888889857973204788-----9992799999999999998669970663


Q ss_pred             CCHHH-HHHHHCCCCCCCCCCCEEECCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHHH
Q ss_conf             74343-10110133211244412320432001157886157865424702577877538963332245499998999999
Q gi|254780628|r  254 SNHSF-LGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLM  332 (395)
Q Consensus       254 s~fak-~~~~s~hn~~Yw~~~d~iG~G~GA~S~l~~~~~~~~~~~~~~~~~Y~~~i~~~~~p~~~~~~Ls~~e~~~e~l~  332 (395)
T Consensus       234 SNfAk~pg~es~HN~~YW~~~~YlGiG~gAhs~~~~~R~----~n~~~~~~~~~----------~~e~Ls~~~~~~E~im  299 (353)
T PRK05904        234 SNWTNNFKYISKHNLAYWRTKDWAAIGWGAHGFENNIEY----FFDGSIQNWIL----------IKKVLTDHELYQQILI  299 (353)
T ss_pred             CCCCCCCCCCCCCHHHHCCCCCEEEEECCCCCCCCCEEE----ECCCCCCCHHH----------CCCCCCHHHHHHHHHH
T ss_conf             512379698461118667999879980661425798378----75656100000----------0054898899999999


Q ss_pred             HHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHHHC
Q ss_conf             96562379988899988389964999999998799498559899995675898999999861
Q gi|254780628|r  333 MGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA  394 (395)
Q Consensus       333 ~~LR~~~Gid~~~~~~~fg~~~~~~~~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~l~  394 (395)
T Consensus       300 lgLR~~~Gidl~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~--~~~~~~~~~~~~~~  353 (353)
T PRK05904        300 MGLRLKDGLDLNKEINKEAYLYFKNKLKH------ISINKNNHLRA--DNIDLLNLSIIDIF  353 (353)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHE------EEEECCCCEEE--CHHHHHHHHHHHCC
T ss_conf             76487529273676347899999865434------89812782653--31657776776329