HHsearch alignment for GI: 254780628 and conserved domain: PRK05926

>PRK05926 hypothetical protein; Provisional.
Probab=98.81  E-value=3.9e-08  Score=74.02  Aligned_cols=191  Identities=12%  Similarity=0.169  Sum_probs=130.3

Q ss_pred             EEEECC---CCCCCCCCCCCEEEECCCCCCHHHHH---HHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             999406---51183765773024578866288999---999999999987618950589996288888789999999997
Q gi|254780628|r   21 VYVHWP---FCVKKCPYCDFNSHVRRYKVGQENFI---QSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILD   94 (395)
Q Consensus        21 lYihiP---FC~~~C~yC~f~~~~~~~~~~~~~y~---~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~   94 (395)
T Consensus        69 ~nr~INyTNvC~~~C~FCaF~r~~~~----~~aY~ls~eei~~~v~e---~--~~g~tEv~i~GG~hP~l~~~yY~~l~~  139 (371)
T PRK05926         69 STLYLYPTNFCDFNCTFCSFYAKPGD----PKGWFYTPDQLIQSIQE---I--KSPITETHIVAGCFPSCNLAYYEELFS  139 (371)
T ss_pred             EECCCCCCHHHHCCCCCCCCCCCCCC----CCCCCCCHHHHHHHHHH---H--HCCCCEEEEECCCCCCCCHHHHHHHHH
T ss_conf             24586521134267924776368999----76523899999999999---8--759968997178898998699999999


Q ss_pred             HHHHCCCCCC-----CCCCCCCCCCCCC-HHHHHHHHHHCCCCCEE-EECCCCCCHHHHHHHC-CCCCHHHHHHHHHHHC
Q ss_conf             6640476444-----3321133210410-02347766303454114-3234332013455422-4431347899998630
Q gi|254780628|r   95 GIAKNWTVSS-----NVEITIEANPSSV-EVNNFQGYRKAGVNRIS-LGVQSLEEQSLRFLGR-NHNASEAIAAIHLARN  166 (395)
Q Consensus        95 ~i~~~~~~~~-----~~e~t~E~~P~~~-~~~~l~~l~~~Gv~RiS-~GvQs~~~~~l~~~~R-~~~~~~~~~~~~~~~~  166 (395)
T Consensus       140 ~ik~~~P~v~ihaft~~EI~~~a~~~~~s~~EvL~~Lk~AGL~SlPGgGAEIl~d~VR~~I~p~K~~~~~Wlei~~~AH~  219 (371)
T PRK05926        140 KIKENFPDIHIKALTAIEYAYLSKLDNLPVREVLQTLKIAGLDSIPGGGAEILVDEIRETLAPGRLSSQDFLEIHKTAHS  219 (371)
T ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             99975898741448899999999980999999999999838777888732434778999758898989999999999998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCC---CEEEEEEEE-ECCCEEHHHHHC
Q ss_conf             2444333210002585432211127887531800---123464688-259600014544
Q gi|254780628|r  167 IFPRMSFDLIYALPKQTMTQWEMELQRALSYAVD---HLSLYQLTI-EKGTLFYKMHKD  221 (395)
Q Consensus       167 ~~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~---~is~Y~l~i-~~~t~l~~~~~~  221 (395)
T Consensus       220 lGi~t~ATMmyGH-iEt~~~rv~HL~~lR~lQdeTgGF~~FIpl~F~p~nt~l~~~~~~  277 (371)
T PRK05926        220 LGIPSNATMLCYH-RETPEDIVTHMSKLRDLQDETLGFKNFILLKFASENNALGKRLRK  277 (371)
T ss_pred             CCCCCCEEEECCC-CCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCC
T ss_conf             6997520465246-699999999999999988752994299724424778822020268