HHsearch alignment for GI: 254780628 and conserved domain: PRK06294

>PRK06294 coproporphyrinogen III oxidase; Provisional.
Probab=100.00  E-value=0  Score=719.32  Aligned_cols=367  Identities=30%  Similarity=0.513  Sum_probs=340.0

Q ss_pred             CCCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHH-HHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHH
Q ss_conf             8988549999406511837657730245788662889999999999-999876189505899962888887899999999
Q gi|254780628|r   14 QGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEM-QWMRQLTGPRSISSIFFGGGTPSLIEPQNIALI   92 (395)
Q Consensus        14 ~~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei-~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~l   92 (395)
T Consensus         2 ~~~~PlsLYiHIPFC~~~C~yC~f~~~~~~~-~~~~~Y~~al~~e~~~~~~~~~~~~~~~tiy~GGGTPs~L~~~~L~~l   80 (374)
T PRK06294          2 NGKTPLALYIHIPFCSKKCHYCSFYTIPYKE-ESVSLYCNAVIKEGLKKLAPLRCTHFIDTVFFGGGTPSLVPPDLIQDI   80 (374)
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCCEEECCCC-CCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHCCHHHHHHH
T ss_conf             8897448998627899879999881024882-339999999999999997643489817999978970163889999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCC-CCCC
Q ss_conf             976640476444332113321041002347766303454114323433201345542244313478999986302-4443
Q gi|254780628|r   93 LDGIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-FPRM  171 (395)
Q Consensus        93 l~~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~-~~~v  171 (395)
T Consensus        81 l~~i~~~----~~~E~TiE~nP~~~~~~~l~~l~~~GinRlSlGVQsf~d~~l~~lgR~h~~~~~~~~i~~~~~~gf~~i  156 (374)
T PRK06294         81 LKTLEAP----HATEITLEANPENLSFSYLRALAQTPINRISIGVQTFDDPLLKLLGRTHSSSAAIEAVLECYEHGFSNL  156 (374)
T ss_pred             HHHHCCC----CCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEEECCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             9974016----884389985347699999999997298759897210767889873899999999999999997599743


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             33210002585432211127887531800123464688259600014544980211035678899986557887096242
Q gi|254780628|r  172 SFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAY  251 (395)
Q Consensus       172 ~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~~~GY~~Y  251 (395)
T Consensus       157 niDLIyGlPgQt~~~~~~~l~~~~~l~p~hiS~Y~L~iep~t~~~~~~~~~~~~~p~~~~~~~~~~~~~~~L~~~Gy~~y  236 (374)
T PRK06294        157 SIDLIYGLPTQSLSDFIMDLHQALTLPITHISLYNLTIDPHTSFYKHRKILLPSIADEDILAEMSLAAEELLTSQGFERY  236 (374)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEECCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHH
T ss_conf             32110478888889999999999734967455555576589658886133899998999999999999999997598301


Q ss_pred             CCCCHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHH
Q ss_conf             36743431011013321124441232043200115788615786542470257787753896333224549999899999
Q gi|254780628|r  252 EISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFL  331 (395)
Q Consensus       252 eis~fak~~~~s~hn~~Yw~~~d~iG~G~GA~S~l~~~~~~~~~~~~~~~~~Y~~~i~~~~~p~~~~~~Ls~~e~~~e~l  331 (395)
T Consensus       237 eisnfak~~~~~~hn~~yw~~~~~lG~G~gA~s~~~~----~~~~N~~~~~~Y~~~i~~~~~~~~~~~~l~~~~~~~e~l  312 (374)
T PRK06294        237 ELASYAKPQAYSKHNTYYWTDRPFLGLGVSASQYLHG----IRSKNLSRISHYLRAVRKNLPTQESMEELPPNERIKEAL  312 (374)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCEEEEECCEEEECCC----EEEEECCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHH
T ss_conf             1566635996030412345799759993692100798----169815999999999987999410444569858999999


Q ss_pred             HHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHHHC
Q ss_conf             996562379988899988389964999999998799498559899995675898999999861
Q gi|254780628|r  332 MMGLRLREGISVKDWEMLAGRNLDIECERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA  394 (395)
Q Consensus       332 ~~~LR~~~Gid~~~~~~~fg~~~~~~~~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~l~  394 (395)
T Consensus       313 ~~~Lrl~~gv~~~~f~~~~----~~~~l~~~~~~Gll~-~~~~~l~LT~~G~l~~d~I~~~ll  370 (374)
T PRK06294        313 ALRLRLCQGIPIADFPQEL----ILELTMQPSIQGLFT-QNDQILSLNKQGRLFHDTIAEEIM  370 (374)
T ss_pred             HHHHHHCCCCCHHHHHHHH----HHHHHHHHHHCCCEE-EECCEEEECHHHHHHHHHHHHHHH
T ss_conf             9829852898789966988----999999999889889-849999999426279999999985