HHsearch alignment for GI: 254780628 and conserved domain: PRK06582

>PRK06582 coproporphyrinogen III oxidase; Provisional.
Probab=100.00  E-value=0  Score=755.02  Aligned_cols=378  Identities=42%  Similarity=0.785  Sum_probs=354.5

Q ss_pred             CCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             98854999940651183765773024578866288999999999999987618950589996288888789999999997
Q gi|254780628|r   15 GSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILD   94 (395)
Q Consensus        15 ~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~   94 (395)
T Consensus         8 ~~~~lsLYiHIPFC~~~C~yC~f~~~~~~~~-~~~~y~~~l~~Ei~~~~~~~~~~~i~tiy~GGGTPs~L~~~~l~~l~~   86 (390)
T PRK06582          8 MANDLSIYIHWPFCLSKCPYCDFNSHVASTI-DHNQWLKSYEKEIEYFKDIIQNKYIKSIFFGGGTPSLMNPVIVEGIIN   86 (390)
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCCCEECCCC-CHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHCCHHHHHHHHH
T ss_conf             0777499998389988089993907148858-899999999999999887647980579998985135289999999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCC
Q ss_conf             66404764443321133210410023477663034541143234332013455422443134789999863024443332
Q gi|254780628|r   95 GIAKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFD  174 (395)
Q Consensus        95 ~i~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~~~~v~iD  174 (395)
T Consensus        87 ~l~~~~~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGVQsf~~~~L~~lgR~h~~~~~~~~i~~~~~~f~niniD  166 (390)
T PRK06582         87 KISNLAIIDNQTEITLETNPTSFETEKFKAFKSAGINRVSIGVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFPRVSFD  166 (390)
T ss_pred             HHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99985788887348998443206198999998559867999713389899997189988999999999998746335445


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             10002585432211127887531800123464688259600014544980211035678899986557887096242367
Q gi|254780628|r  175 LIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHGLHAYEIS  254 (395)
Q Consensus       175 li~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~~~GY~~Yeis  254 (395)
T Consensus       167 LI~GlP~QT~~~~~~~L~~~~~l~p~hiS~Y~L~ie~~t~~~~~~~~g~~~lp~~d~~~~~y~~~~~~L~~~Gy~~yeis  246 (390)
T PRK06582        167 LIYARSGQTLKDWQEELKQAMQLATSHISLYQLTIEKGTPFYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEIS  246 (390)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEECCC
T ss_conf             41479999899999999999833898517898885379778888741898999889999999999999984598604450


Q ss_pred             CHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCCCEE-EEEEECCCHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHH
Q ss_conf             434310110133211244412320432001157886157-8654247025778775389633322454999989999999
Q gi|254780628|r  255 NHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRV-AISIEKHPESWLKMVRKNGHAVVEKEFLSSEQQADEFLMM  333 (395)
Q Consensus       255 ~fak~~~~s~hn~~Yw~~~d~iG~G~GA~S~l~~~~~~~-~~~~~~~~~~Y~~~i~~~~~p~~~~~~Ls~~e~~~e~l~~  333 (395)
T Consensus       247 nfakpg~e~~HN~~yW~~~~ylG~G~gA~s~~~~~~~~~~~~~~~~~~~~y~~~i~~~~~~i~~~~~Ls~~d~~~e~ii~  326 (390)
T PRK06582        247 NYAKIGQECLHNLTYWNYNSYLGIGPGAHSRIIENSSSVSAIMMWHKPEKWLDAVKTKNVGIQTNTKLTHQEIIEEILMM  326 (390)
T ss_pred             CCCCCCHHHHHHHCCCCCCCCEEECCCEEEEECCCCCCHHHHHHHCCHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHH
T ss_conf             00478777754432356998089764807761168753137776408999999997499965555518988999999999


Q ss_pred             HHHHCCCCCHHHHHHHHCCCHHHH----HHHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHHHCC
Q ss_conf             656237998889998838996499----99999987994985598999956758989999998619
Q gi|254780628|r  334 GLRLREGISVKDWEMLAGRNLDIE----CERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV  395 (395)
Q Consensus       334 ~LR~~~Gid~~~~~~~fg~~~~~~----~~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~l~i  395 (395)
T Consensus       327 gLR~~~Gid~~~~~~~fg~~~~~~~~~~~l~~l~~~gLi~-~d-~~i~LT~kG~ll~n~I~~~ll~  390 (390)
T PRK06582        327 GLRLSKGINISTLEQKLNTKLENILDMNNLKHYQALDLIR-LD-ENIYLTDKGLMLHSYIVPRLII  390 (390)
T ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHCHHHHHHHHHCCCEE-EC-CEEEECHHHHHHHHHHHHHHHC
T ss_conf             8998689089999999893999971989999999797989-89-9899996688899999999719