HHsearch alignment for GI: 254780628 and conserved domain: PRK08207

>PRK08207 coproporphyrinogen III oxidase; Provisional.
Probab=100.00  E-value=0  Score=587.67  Aligned_cols=295  Identities=25%  Similarity=0.453  Sum_probs=269.8

Q ss_pred             CCCCCEEEEEECCCCCCCCCCCCCEEEECC-CCCCHHHHHHHHHHHHHHHHHHHC--CCEEEEEEECCCCCCCCCHHHHH
Q ss_conf             898854999940651183765773024578-866288999999999999987618--95058999628888878999999
Q gi|254780628|r   14 QGSNSLGVYVHWPFCVKKCPYCDFNSHVRR-YKVGQENFIQSFLTEMQWMRQLTG--PRSISSIFFGGGTPSLIEPQNIA   90 (395)
Q Consensus        14 ~~~~~l~lYihiPFC~~~C~yC~f~~~~~~-~~~~~~~y~~~l~~Ei~~~~~~~~--~~~~~~iy~GGGTPs~l~~~~l~   90 (395)
T Consensus       168 ~~~~~~SLYIHIPFC~~kC~YCdF~s~~i~~~~~~v~~Yl~aL~kEI~~~~~~l~~~~~~i~TIY~GGGTPS~Ls~~ql~  247 (497)
T PRK08207        168 KDKNEVSIYIGIPFCPTRCLYCSFPSYPINGRKGLVEPYLEALHYEIEEIGKYLKEKGLKIETIYFGGGTPTSITAEEFE  247 (497)
T ss_pred             CCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECEEEECCCCCCCCCHHHHH
T ss_conf             37884799998189589878999803115776331999999999999999987623798035699799810029999999


Q ss_pred             HHHHHHHHCC-CCCCCCCCCCCCC-CCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCC-
Q ss_conf             9997664047-6444332113321-041002347766303454114323433201345542244313478999986302-
Q gi|254780628|r   91 LILDGIAKNW-TVSSNVEITIEAN-PSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNI-  167 (395)
Q Consensus        91 ~ll~~i~~~~-~~~~~~e~t~E~~-P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~-  167 (395)
T Consensus       248 ~ll~~i~~~F~~~~~~~EiTvEanRPdtit~ekL~~lk~~GvnRiSiGvQSf~~~~Lk~lGR~Ht~~~~~~a~~~ar~~G  327 (497)
T PRK08207        248 KLLEEIYESFPDVKNVKEFTVEAGRPDTITEEKLEVLKKYNVDRISINPQSMNDETLKAIGRHHTVEDIIEKFHLARELG  327 (497)
T ss_pred             HHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCC
T ss_conf             99999998657689997799978798962999999999759875888353299899998189999999999999999859


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             44433321000258543221112788753180012346468825960001454498021103567889998655788709
Q gi|254780628|r  168 FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSITSAHG  247 (395)
Q Consensus       168 ~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~L~~~G  247 (395)
T Consensus       328 F~nIN~DLI~GLPgqt~~~~~~tL~~i~~L~Pd~iTvhsLaikr~s~l~~~~~--~~~l~~~~~~~~m~~~~~~~~~~~g  405 (497)
T PRK08207        328 FDNINMDLIIGLPGEGLEEFKHTLEEIEKLMPDSLTVHTLSIKRASRLTENKE--KYKVADREEINAMMEEAEEWAKELG  405 (497)
T ss_pred             CCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEECCCCHHHHCCC--CCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             98497743537999999999999999981399825876665546860222455--6689985899999999999999779


Q ss_pred             CCCC------------CCCCHHHHHHHHCCCCCCCC-CCCEEECCCCCCCCCC--CCCCEEEEEEECCCHHHHHHHHC
Q ss_conf             6242------------36743431011013321124-4412320432001157--88615786542470257787753
Q gi|254780628|r  248 LHAY------------EISNHSFLGAESLHNLNYWR-YGDYIGIGPGAHSRVK--VGSHRVAISIEKHPESWLKMVRK  310 (395)
Q Consensus       248 Y~~Y------------eis~fak~~~~s~hn~~Yw~-~~d~iG~G~GA~S~l~--~~~~~~~~~~~~~~~~Y~~~i~~  310 (395)
T Consensus       406 ~~pYYlYRQKnm~gn~EnvgYak~G~e~~yNI~imeE~qtiig~GaGA~sKiv~~~~~ri~R~~N~Kd~~~Yi~ride  483 (497)
T PRK08207        406 YVPYYLYRQKNMLGNLENVGYAKPGKESIYNIQIMEEKQTIIGLGAGAVSKFVFPKEGRIERFANPKDPKEYNERVDE  483 (497)
T ss_pred             CCCCHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHCCEEEECCCCCEEEEECCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             984101343044655202332268975254799987207689985883115775589817870588998999999999