HHsearch alignment for GI: 254780628 and conserved domain: PRK08208

>PRK08208 coproporphyrinogen III oxidase; Validated.
Probab=100.00  E-value=0  Score=724.65  Aligned_cols=383  Identities=22%  Similarity=0.354  Sum_probs=346.3

Q ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCC
Q ss_conf             78998842889885499994065118376577302457886628899999999999998761895058999628888878
Q gi|254780628|r    5 SAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLI   84 (395)
Q Consensus         5 ~~~~~~~~~~~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l   84 (395)
T Consensus        32 ~~~~~~~~~~~~~~LsLYiHiPFC~~~C~YC~f~~~~~~~~~~~~~Y~~aL~~Ei~~~~~~~~~~~~~tiy~GGGTPS~L  111 (436)
T PRK08208         32 VSLSEVWPREYEDALHLYIHIPFCESRCGFCNLFTCTGADNEFIDSYLDALIRQARQVALALGGVHFASFAVGGGTPTLL  111 (436)
T ss_pred             HHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHCC
T ss_conf             76999984399997499987044079588999837668983389999999999999987663898356899679432219


Q ss_pred             CHHHHHHHHHHHHHCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             9999999997664047644-433211332104100234776630345411432343320134554224431347899998
Q gi|254780628|r   85 EPQNIALILDGIAKNWTVS-SNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHL  163 (395)
Q Consensus        85 ~~~~l~~ll~~i~~~~~~~-~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~  163 (395)
T Consensus       112 ~~~~l~~ll~~l~~~f~~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGVQsf~~~~L~~lgR~h~~~~~~~ai~~  191 (436)
T PRK08208        112 NIAQLEKLFFSVFDVLGVDLWNIPKSVETSPTTTTAEKLALLNAFGVNRVSIGVQSFHDSELHALHRRQNAASVHQALEL  191 (436)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99999999999998589984671599986636360999999997398727874144898999984688999999999999


Q ss_pred             HHCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             6302-444333210002585432211127887531800123464688259600014544980211035678899986557
Q gi|254780628|r  164 ARNI-FPRMSFDLIYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQSI  242 (395)
Q Consensus       164 ~~~~-~~~v~iDli~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~~~p~~~~~~~~~~~a~e~  242 (395)
T Consensus       192 ~r~~gf~niniDLIyGlPgQt~~~~~~~l~~~l~l~p~HIS~Y~L~iep~T~l~~~~------~~~~d~~~~my~~a~~~  265 (436)
T PRK08208        192 IRAAHFPSLNIDLIYGIPGQTHASFMESLHQALVYRPEELFLYPLYVRPLTGLGRRG------TAWDDNMHSLYVLARDL  265 (436)
T ss_pred             HHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCCCEECCCCCCCCCC------CCCCHHHHHHHHHHHHH
T ss_conf             998199857552443699999999999999998279898987633047898301247------98937999999999999


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHCCCCCCC-CCCCEEECCCCCCCCCCCCCCEEEEE-EECCCHHHHHHH--HCCCCCCCCE
Q ss_conf             8870962423674343101101332112-44412320432001157886157865-424702577877--5389633322
Q gi|254780628|r  243 TSAHGLHAYEISNHSFLGAESLHNLNYW-RYGDYIGIGPGAHSRVKVGSHRVAIS-IEKHPESWLKMV--RKNGHAVVEK  318 (395)
Q Consensus       243 L~~~GY~~Yeis~fak~~~~s~hn~~Yw-~~~d~iG~G~GA~S~l~~~~~~~~~~-~~~~~~~Y~~~i--~~~~~p~~~~  318 (395)
T Consensus       266 L~~~Gy~~YeisnFak~~~~~~hn~~y~~~~~~ylGlG~gA~S~~~~~r~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~g  345 (436)
T PRK08208        266 LLNAGYTQTSMRRFVRNDAPSAAAPSYSCQFEGMLGLGAGARSYLGNLHYSSPYAVNQQTIRSIIQNYIDRPDFTVANHG  345 (436)
T ss_pred             HHHCCCHHHHHHHHCCCCHHHHHCCCCCCCCCCEEEEECCEEEECCCCCCCCHHHHCCCHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99769443348662089836664602536899889994767998898554635754221189999999855786520002


Q ss_pred             EECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHH--HHHHHHCCCEEEEECCEEEECHHHHHHHHHHHHHHC
Q ss_conf             4549999899999996562379988899988389964999--999998799498559899995675898999999861
Q gi|254780628|r  319 EFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIEC--ERNLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLA  394 (395)
Q Consensus       319 ~~Ls~~e~~~e~l~~~LR~~~Gid~~~~~~~fg~~~~~~~--~~~L~~~Gli~~~~~~~l~lT~~G~~~~d~I~~~l~  394 (395)
T Consensus       346 ~~Ls~~d~~~e~ii~~Lr~~~Gvd~~~f~~~fg~~~~~~~~~l~~l~~~GLl~-~~~~~l~LT~~G~~~~d~I~~~F~  422 (436)
T PRK08208        346 YLLSPDEMKRRFIIKSLLFWQGLDLSDYRQRFGSDALRDFPELEEFIDQGWCY-QNGSRVRLTETGLAYSDCLGPVFI  422 (436)
T ss_pred             EECCHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEE-EECCEEEECHHHHHHHHHHHHHHC
T ss_conf             00798899999999999986898999999998959999999999999788889-709999999758899999999876