HHsearch alignment for GI: 254780628 and conserved domain: TIGR02491

>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837 This enzyme is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO). The two components form an alpha-2/beta-2 heterodimer.; GO: 0043365 [formate-C-acetyltransferase]-activating enzyme activity, 0051539 4 iron 4 sulfur cluster binding, 0005737 cytoplasm.
Probab=92.01  E-value=0.52  Score=26.84  Aligned_cols=87  Identities=21%  Similarity=0.455  Sum_probs=54.8

Q ss_pred             HHCCCCCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCC-EEEEEEECCCCCCC-CCHH
Q ss_conf             842889885499994065118376577302457886628899999999999998761895-05899962888887-8999
Q gi|254780628|r   10 NMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPR-SISSIFFGGGTPSL-IEPQ   87 (395)
Q Consensus        10 ~~~~~~~~~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~-~~~~iy~GGGTPs~-l~~~   87 (395)
T Consensus        10 ~vNG~G~R-~slfv--aGC~H~C~GC-~N~~TW~~~~G~~-~t~~~~~~i~~--~l~~~~~~~~G~tlsGGDPL~~~N~~   82 (158)
T TIGR02491        10 IVNGEGIR-VSLFV--AGCKHHCEGC-FNKETWNFNGGEE-FTEELEKEIIR--DLNDNPILIDGLTLSGGDPLYPANVE   82 (158)
T ss_pred             EECCCCEE-EEEEE--CCCCCCCCCC-CCCCCCCCCCCCC-CCHHHHHHHHH--HHCCCCCEEEEEEECCCCCCCCCCHH
T ss_conf             35488048-99860--4760388888-7835557678942-03688999999--85128816630143188888724436


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             9999997664047644
Q gi|254780628|r   88 NIALILDGIAKNWTVS  103 (395)
Q Consensus        88 ~l~~ll~~i~~~~~~~  103 (395)
T Consensus        83 ~~~~l~k~~k~~~P~k   98 (158)
T TIGR02491        83 ELIELVKKIKAELPEK   98 (158)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             8999999999857899