HHsearch alignment for GI: 254780628 and conserved domain: TIGR02668

>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO).; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=98.11  E-value=1.4e-05  Score=57.14  Aligned_cols=171  Identities=15%  Similarity=0.225  Sum_probs=115.3

Q ss_pred             CCCCCCCCCCCCEEEECC--CCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             651183765773024578--866288999999999999987618950589996288888789999999997664047644
Q gi|254780628|r   26 PFCVKKCPYCDFNSHVRR--YKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVS  103 (395)
Q Consensus        26 PFC~~~C~yC~f~~~~~~--~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~~i~~~~~~~  103 (395)
T Consensus        18 ~~CN~~CfyCH~EG~~~~~~r~gp~~~~Ls~--eei~~~~~~a~~fGV~kvKlTGGEPlL--R~D~~~Ii~~~~~~----   89 (324)
T TIGR02668        18 DECNLSCFYCHREGEDESRGRQGPGGNELSP--EEIERIVRVASEFGVRKVKLTGGEPLL--RKDLIEIIRRIKDY----   89 (324)
T ss_pred             CCCCCCCEEECCCCCCCCCCCCCCCCCCCCH--HHHHHHHHHHHHCCCCEEEECCCCCCH--HHHHHHHHHHHCCC----
T ss_conf             4238642210367888888888886445589--999999999987088327751787434--56699999861467----


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHH--CCCCCHHHHHHHHHHHCCCCC---CCCCCCCC
Q ss_conf             4332113321041002347766303454114323433201345542--244313478999986302444---33321000
Q gi|254780628|r  104 SNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLG--RNHNASEAIAAIHLARNIFPR---MSFDLIYA  178 (395)
Q Consensus       104 ~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~--R~~~~~~~~~~~~~~~~~~~~---v~iDli~G  178 (395)
T Consensus        90 ~~~~vSmTTN-G~LL~~~A~~Lk~AGLdRVNVSLdtld~e~Y~kITG~~~~~~~~Vi~GI~~A~~~GL~PVKlN---~Vv  165 (324)
T TIGR02668        90 GIKDVSMTTN-GILLEKLAKKLKEAGLDRVNVSLDTLDPEKYKKITGQSRDALDRVIEGIESAVDAGLTPVKLN---MVV  165 (324)
T ss_pred             CCEEEECCCC-HHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCEEEE---EEE
T ss_conf             5034420303-144898999999828561312026788678886448998607899999999997289813788---887


Q ss_pred             CCCCCCCC-CCCCHHHHHH-CCCCCEEEEEEE
Q ss_conf             25854322-1112788753-180012346468
Q gi|254780628|r  179 LPKQTMTQ-WEMELQRALS-YAVDHLSLYQLT  208 (395)
Q Consensus       179 lPgqt~e~-~~~~l~~~~~-l~p~~is~Y~l~  208 (395)
T Consensus       166 l~G~N~~~~~~~m~~f~~~~~~g~~LQlIEl~  197 (324)
T TIGR02668       166 LKGINDNEEIPDMVEFAADYEGGAILQLIELM  197 (324)
T ss_pred             ECCCCCCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             54778850079999999875159368986112