HHsearch alignment for GI: 254780628 and conserved domain: TIGR03471

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Probab=99.93  E-value=4.9e-25  Score=186.02  Aligned_cols=187  Identities=16%  Similarity=0.208  Sum_probs=155.1

Q ss_pred             CCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             11837657730245788662889999999999999876189505899962888887899999999976640476444332
Q gi|254780628|r   28 CVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVE  107 (395)
Q Consensus        28 C~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~~~~~~~~iy~GGGTPs~l~~~~l~~ll~~i~~~~~~~~~~e  107 (395)
T Consensus       206 CP~~C~FC~~p~~~-~Gr~~R~RSpe~VvdEIe~l~~~y~g--v~~~~f~DD~Ft~-~~~r~~eic~~i~~-l~i~----  276 (472)
T TIGR03471       206 CPSKCTFCLWPQTV-GGHRYRTRSAESVIEEVKYALENFPE--VREFFFDDDTFTD-DKPRAEEIARKLGP-LGVT----  276 (472)
T ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHHCCC--CCEEEEECCCCCC-CHHHHHHHHHHHHH-CCCE----
T ss_conf             88779687882102-68866215999999999999986689--7589994776678-99999999999987-6982----


Q ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11332104100234776630345411432343320134554224431347899998630244433321000258543221
Q gi|254780628|r  108 ITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALPKQTMTQW  187 (395)
Q Consensus       108 ~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~~~~v~iDli~GlPgqt~e~~  187 (395)
T Consensus       277 W~~~~Rv~-~d~E~l~~mk~AGc~~v~~GiESgsq~iL~~i~K~~t~e~~~~av~~~k~~GI~v~~~FIiG~PgET~Eti  355 (472)
T TIGR03471       277 WSCNARAN-VDYETLKVMKENGLRLLLVGYESGDQQILKNIKKGLTVEIARRFTRDCHKLGIKVHGTFILGLPGETRETI  355 (472)
T ss_pred             EEEEEECC-CCHHHHHHHHHHCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHH
T ss_conf             78763034-89999999998398489980375899999985389989999999998875798799999877999988999


Q ss_pred             CCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHCCCC
Q ss_conf             1127887531800123464688259600014544980
Q gi|254780628|r  188 EMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDL  224 (395)
Q Consensus       188 ~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~~~~  224 (395)
T Consensus       356 ~~Ti~fa~~l~~d~~~~si~tPyPGT~ly~~~~e~g~  392 (472)
T TIGR03471       356 RKTIDFAKELNPHTIQVSLAAPYPGTELYDQAKQNGW  392 (472)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHCCC
T ss_conf             9999999975989089987258899699999998398