HHsearch alignment for GI: 254780628 and conserved domain: smart00729

>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
Probab=99.97  E-value=4.7e-30  Score=219.26  Aligned_cols=201  Identities=28%  Similarity=0.538  Sum_probs=176.5

Q ss_pred             CEEEEEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHH-CCCEEEEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             5499994065118376577302457886628899999999999998761-895058999628888878999999999766
Q gi|254780628|r   18 SLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQWMRQLT-GPRSISSIFFGGGTPSLIEPQNIALILDGI   96 (395)
Q Consensus        18 ~l~lYihiPFC~~~C~yC~f~~~~~~~~~~~~~y~~~l~~Ei~~~~~~~-~~~~~~~iy~GGGTPs~l~~~~l~~ll~~i   96 (395)
T Consensus         1 ~~~~~~~sRGC~~~C~fC~~~~~~~~---~~~~~~~~i~~ei~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i   77 (216)
T smart00729        1 PLALYIITRGCPRRCTFCSFPSARGK---LRSRYLEALVREIELLAEKGEKEILVGTVFIGGGTPTLLSPEQLEELLEAI   77 (216)
T ss_pred             CEEEEEEECCCCCCCCCCCCCCCCCC---CCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             97999998781984842981758896---457599999999999997089765300110024689888999999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHCCC-CCCCCCC
Q ss_conf             404764443321133210410023477663034541143234332013455422443134789999863024-4433321
Q gi|254780628|r   97 AKNWTVSSNVEITIEANPSSVEVNNFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIF-PRMSFDL  175 (395)
Q Consensus        97 ~~~~~~~~~~e~t~E~~P~~~~~~~l~~l~~~Gv~RiS~GvQs~~~~~l~~~~R~~~~~~~~~~~~~~~~~~-~~v~iDl  175 (395)
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~e~l~~l~~~g~~~v~~giEs~~~~~l~~i~k~~~~~~~~~~i~~~~~~g~~~~~~~~  157 (216)
T smart00729       78 REILGLADDVEITIETRPGTLTEELLEALKEAGVNRVSLGVQSGSDEVLKAINRGHTVEDVLEAVEKLREAGPIKVSTDL  157 (216)
T ss_pred             HHHCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             98514356269999706021589999999984998666673550789998717999999999999999985893687757


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEEEECCCEEHHHHHC
Q ss_conf             0002585432211127887531800123464688259600014544
Q gi|254780628|r  176 IYALPKQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKD  221 (395)
Q Consensus       176 i~GlPgqt~e~~~~~l~~~~~l~p~~is~Y~l~i~~~t~l~~~~~~  221 (395)
T Consensus       158 i~GlP~et~e~~~~t~~~~~~~~~~~i~~~~~~p~pgT~~~~~~~~  203 (216)
T smart00729      158 IVGLPGETEEDFEETLKLLKELGPDRVSIFPLSPRPGTPLAKLYKR  203 (216)
T ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCEECCCCHHHHCCCC
T ss_conf             8679999999999999999946919899874875699846650162